Anti BBX pAb (ATL-HPA006049 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA006049-25
  • Immunohistochemistry analysis in human testis and skeletal muscle tissues using HPA006049 antibody. Corresponding BBX RNA-seq data are presented for the same tissues.
  • Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: bobby sox homolog (Drosophila)
Gene Name: BBX
Alternative Gene Name: HBP2, HSPC339, MDS001
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022641: 85%, ENSRNOG00000001971: 84%
Entrez Gene ID: 56987
Uniprot ID: Q8WY36
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NSLPQYSPVTFDRKCVPVPRKKKKTGNVSSEPTKTSKGSGDKWSNKQLFLDAIHPTEAIFSEDRNTMEPVHKVKNIPSIFNTPEPTTTQEPLVGSQKRKARKTKI
Gene Sequence NSLPQYSPVTFDRKCVPVPRKKKKTGNVSSEPTKTSKGSGDKWSNKQLFLDAIHPTEAIFSEDRNTMEPVHKVKNIPSIFNTPEPTTTQEPLVGSQKRKARKTKI
Gene ID - Mouse ENSMUSG00000022641
Gene ID - Rat ENSRNOG00000001971
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti BBX pAb (ATL-HPA006049 w/enhanced validation)
Datasheet Anti BBX pAb (ATL-HPA006049 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti BBX pAb (ATL-HPA006049 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti BBX pAb (ATL-HPA006049 w/enhanced validation)
Datasheet Anti BBX pAb (ATL-HPA006049 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti BBX pAb (ATL-HPA006049 w/enhanced validation)