Anti BBS9 pAb (ATL-HPA021289)
Atlas Antibodies
- Catalog No.:
- ATL-HPA021289-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: BBS9
Alternative Gene Name: B1, PTHB1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035919: 85%, ENSRNOG00000015189: 85%
Entrez Gene ID: 27241
Uniprot ID: Q3SYG4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | QEDTQELGWEETVDAAISHLLKTCLSKSSKEQALNLNSQLNIPKDTSQLKKHITLLCDRLSKGGRLCLSTDAAAPQTMVMPGGCTTIPESDLEERSVEQDSTELFTNHRHLTAETPRPEVSPLQ |
| Gene Sequence | QEDTQELGWEETVDAAISHLLKTCLSKSSKEQALNLNSQLNIPKDTSQLKKHITLLCDRLSKGGRLCLSTDAAAPQTMVMPGGCTTIPESDLEERSVEQDSTELFTNHRHLTAETPRPEVSPLQ |
| Gene ID - Mouse | ENSMUSG00000035919 |
| Gene ID - Rat | ENSRNOG00000015189 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti BBS9 pAb (ATL-HPA021289) | |
| Datasheet | Anti BBS9 pAb (ATL-HPA021289) Datasheet (External Link) |
| Vendor Page | Anti BBS9 pAb (ATL-HPA021289) at Atlas Antibodies |
| Documents & Links for Anti BBS9 pAb (ATL-HPA021289) | |
| Datasheet | Anti BBS9 pAb (ATL-HPA021289) Datasheet (External Link) |
| Vendor Page | Anti BBS9 pAb (ATL-HPA021289) |
| Citations for Anti BBS9 pAb (ATL-HPA021289) – 6 Found |
| Ye, Fan; Nager, Andrew R; Nachury, Maxence V. BBSome trains remove activated GPCRs from cilia by enabling passage through the transition zone. The Journal Of Cell Biology. 2018;217(5):1847-1868. PubMed |
| Gupta, Priya R; Pendse, Nachiket; Greenwald, Scott H; Leon, Mihoko; Liu, Qin; Pierce, Eric A; Bujakowska, Kinga M. Ift172 conditional knock-out mice exhibit rapid retinal degeneration and protein trafficking defects. Human Molecular Genetics. 2018;27(11):2012-2024. PubMed |
| Humbert, Melissa C; Weihbrecht, Katie; Searby, Charles C; Li, Yalan; Pope, Robert M; Sheffield, Val C; Seo, Seongjin. ARL13B, PDE6D, and CEP164 form a functional network for INPP5E ciliary targeting. Proceedings Of The National Academy Of Sciences Of The United States Of America. 2012;109(48):19691-6. PubMed |
| Zhang, Yan; Seo, Seongjin; Bhattarai, Sajag; Bugge, Kevin; Searby, Charles C; Zhang, Qihong; Drack, Arlene V; Stone, Edwin M; Sheffield, Val C. BBS mutations modify phenotypic expression of CEP290-related ciliopathies. Human Molecular Genetics. 2014;23(1):40-51. PubMed |
| Chamling, Xitiz; Seo, Seongjin; Searby, Charles C; Kim, Gunhee; Slusarski, Diane C; Sheffield, Val C. The centriolar satellite protein AZI1 interacts with BBS4 and regulates ciliary trafficking of the BBSome. Plos Genetics. 2014;10(2):e1004083. PubMed |
| Hsu, Ying; Seo, Seongjin; Sheffield, Val C. Photoreceptor cilia, in contrast to primary cilia, grant entry to a partially assembled BBSome. Human Molecular Genetics. 2021;30(1):87-102. PubMed |