Anti BBS7 pAb (ATL-HPA044592)

Atlas Antibodies

Catalog No.: ATL-HPA044592-25

Protein Description: Bardet-Biedl syndrome 7
Gene Name: BBS7
Alternative Gene Name: BBS2L1, FLJ10715
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037325: 97%, ENSRNOG00000015816: 95%
Entrez Gene ID: 55212
Uniprot ID: Q8IWZ6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: YVTPRIQPKTCQVRQYHIKPLSLHQRTHFIDHDRPMNTLTLTGQFSFAEVHSWVVFCLPEVPEKPPAGECVTFYFQNTFLDTQLESTYRKG
• Gene Sequence: YVTPRIQPKTCQVRQYHIKPLSLHQRTHFIDHDRPMNTLTLTGQFSFAEVHSWVVFCLPEVPEKPPAGECVTFYFQNTFLDTQLESTYRKG
• Gene ID - Mouse: ENSMUSG00000037325
• Gene ID - Rat: ENSRNOG00000015816
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.