Anti BBS7 pAb (ATL-HPA044592)

Atlas Antibodies

Catalog No.:
ATL-HPA044592-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: Bardet-Biedl syndrome 7
Gene Name: BBS7
Alternative Gene Name: BBS2L1, FLJ10715
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037325: 97%, ENSRNOG00000015816: 95%
Entrez Gene ID: 55212
Uniprot ID: Q8IWZ6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YVTPRIQPKTCQVRQYHIKPLSLHQRTHFIDHDRPMNTLTLTGQFSFAEVHSWVVFCLPEVPEKPPAGECVTFYFQNTFLDTQLESTYRKG
Gene Sequence YVTPRIQPKTCQVRQYHIKPLSLHQRTHFIDHDRPMNTLTLTGQFSFAEVHSWVVFCLPEVPEKPPAGECVTFYFQNTFLDTQLESTYRKG
Gene ID - Mouse ENSMUSG00000037325
Gene ID - Rat ENSRNOG00000015816
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti BBS7 pAb (ATL-HPA044592)
Datasheet Anti BBS7 pAb (ATL-HPA044592) Datasheet (External Link)
Vendor Page Anti BBS7 pAb (ATL-HPA044592) at Atlas Antibodies

Documents & Links for Anti BBS7 pAb (ATL-HPA044592)
Datasheet Anti BBS7 pAb (ATL-HPA044592) Datasheet (External Link)
Vendor Page Anti BBS7 pAb (ATL-HPA044592)