Anti BBS5 pAb (ATL-HPA046125)
Atlas Antibodies
- Catalog No.:
- ATL-HPA046125-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: BBS5
Alternative Gene Name: DKFZp762I194
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000063145: 92%, ENSRNOG00000007127: 92%
Entrez Gene ID: 129880
Uniprot ID: Q8N3I7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | DVRFDLSAQQMKTRPGEVLIDCLDSIEDTKGNNGDRGRLLVTNLRILWHSLALSRVNVSVGYNCILNITTRTANSKLR |
Gene Sequence | DVRFDLSAQQMKTRPGEVLIDCLDSIEDTKGNNGDRGRLLVTNLRILWHSLALSRVNVSVGYNCILNITTRTANSKLR |
Gene ID - Mouse | ENSMUSG00000063145 |
Gene ID - Rat | ENSRNOG00000007127 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti BBS5 pAb (ATL-HPA046125) | |
Datasheet | Anti BBS5 pAb (ATL-HPA046125) Datasheet (External Link) |
Vendor Page | Anti BBS5 pAb (ATL-HPA046125) at Atlas Antibodies |
Documents & Links for Anti BBS5 pAb (ATL-HPA046125) | |
Datasheet | Anti BBS5 pAb (ATL-HPA046125) Datasheet (External Link) |
Vendor Page | Anti BBS5 pAb (ATL-HPA046125) |