Anti BBS5 pAb (ATL-HPA046125)

Atlas Antibodies

Catalog No.:
ATL-HPA046125-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: Bardet-Biedl syndrome 5
Gene Name: BBS5
Alternative Gene Name: DKFZp762I194
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000063145: 92%, ENSRNOG00000007127: 92%
Entrez Gene ID: 129880
Uniprot ID: Q8N3I7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DVRFDLSAQQMKTRPGEVLIDCLDSIEDTKGNNGDRGRLLVTNLRILWHSLALSRVNVSVGYNCILNITTRTANSKLR
Gene Sequence DVRFDLSAQQMKTRPGEVLIDCLDSIEDTKGNNGDRGRLLVTNLRILWHSLALSRVNVSVGYNCILNITTRTANSKLR
Gene ID - Mouse ENSMUSG00000063145
Gene ID - Rat ENSRNOG00000007127
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti BBS5 pAb (ATL-HPA046125)
Datasheet Anti BBS5 pAb (ATL-HPA046125) Datasheet (External Link)
Vendor Page Anti BBS5 pAb (ATL-HPA046125) at Atlas Antibodies

Documents & Links for Anti BBS5 pAb (ATL-HPA046125)
Datasheet Anti BBS5 pAb (ATL-HPA046125) Datasheet (External Link)
Vendor Page Anti BBS5 pAb (ATL-HPA046125)