Anti BBS4 pAb (ATL-HPA039418)

Atlas Antibodies

Catalog No.:
ATL-HPA039418-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: Bardet-Biedl syndrome 4
Gene Name: BBS4
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025235: 92%, ENSRNOG00000026171: 91%
Entrez Gene ID: 585
Uniprot ID: Q96RK4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TQFPVSTESQKPRQKKAPEFPILEKQNWLIHLHYIRKDYEACKAVIKEQLQETQGLCEYAIYVQALIFRLEGNIQESL
Gene Sequence TQFPVSTESQKPRQKKAPEFPILEKQNWLIHLHYIRKDYEACKAVIKEQLQETQGLCEYAIYVQALIFRLEGNIQESL
Gene ID - Mouse ENSMUSG00000025235
Gene ID - Rat ENSRNOG00000026171
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti BBS4 pAb (ATL-HPA039418)
Datasheet Anti BBS4 pAb (ATL-HPA039418) Datasheet (External Link)
Vendor Page Anti BBS4 pAb (ATL-HPA039418) at Atlas Antibodies

Documents & Links for Anti BBS4 pAb (ATL-HPA039418)
Datasheet Anti BBS4 pAb (ATL-HPA039418) Datasheet (External Link)
Vendor Page Anti BBS4 pAb (ATL-HPA039418)