Anti BBS4 pAb (ATL-HPA039418)
Atlas Antibodies
- Catalog No.:
- ATL-HPA039418-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: BBS4
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025235: 92%, ENSRNOG00000026171: 91%
Entrez Gene ID: 585
Uniprot ID: Q96RK4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | TQFPVSTESQKPRQKKAPEFPILEKQNWLIHLHYIRKDYEACKAVIKEQLQETQGLCEYAIYVQALIFRLEGNIQESL |
Gene Sequence | TQFPVSTESQKPRQKKAPEFPILEKQNWLIHLHYIRKDYEACKAVIKEQLQETQGLCEYAIYVQALIFRLEGNIQESL |
Gene ID - Mouse | ENSMUSG00000025235 |
Gene ID - Rat | ENSRNOG00000026171 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti BBS4 pAb (ATL-HPA039418) | |
Datasheet | Anti BBS4 pAb (ATL-HPA039418) Datasheet (External Link) |
Vendor Page | Anti BBS4 pAb (ATL-HPA039418) at Atlas Antibodies |
Documents & Links for Anti BBS4 pAb (ATL-HPA039418) | |
Datasheet | Anti BBS4 pAb (ATL-HPA039418) Datasheet (External Link) |
Vendor Page | Anti BBS4 pAb (ATL-HPA039418) |