Anti BBS2 pAb (ATL-HPA041315)

Atlas Antibodies

SKU:
ATL-HPA041315-25
  • Immunohistochemical staining of human fallopian tube shows strong membranous and cytoplasmic positivity in ciliated cells.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: Bardet-Biedl syndrome 2
Gene Name: BBS2
Alternative Gene Name: BBS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031755: 96%, ENSRNOG00000019020: 96%
Entrez Gene ID: 583
Uniprot ID: Q9BXC9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen IVTSLCPMYGSRFGYALSNGTVGVYDKTSRYWRIKSKNHAMSIHAFDLNSDGVNELITGWSNGKVDARSDRTGEVIFKDNFSSAIAGVVEGDYRMDG
Gene Sequence IVTSLCPMYGSRFGYALSNGTVGVYDKTSRYWRIKSKNHAMSIHAFDLNSDGVNELITGWSNGKVDARSDRTGEVIFKDNFSSAIAGVVEGDYRMDG
Gene ID - Mouse ENSMUSG00000031755
Gene ID - Rat ENSRNOG00000019020
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti BBS2 pAb (ATL-HPA041315)
Datasheet Anti BBS2 pAb (ATL-HPA041315) Datasheet (External Link)
Vendor Page Anti BBS2 pAb (ATL-HPA041315) at Atlas Antibodies

Documents & Links for Anti BBS2 pAb (ATL-HPA041315)
Datasheet Anti BBS2 pAb (ATL-HPA041315) Datasheet (External Link)
Vendor Page Anti BBS2 pAb (ATL-HPA041315)