Anti BBS10 pAb (ATL-HPA058743)
Atlas Antibodies
- Catalog No.:
- ATL-HPA058743-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: BBS10
Alternative Gene Name: C12orf58, FLJ23560
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035759: 81%, ENSRNOG00000026913: 78%
Entrez Gene ID: 79738
Uniprot ID: Q8TAM1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LEAYFCGRVGRNNHKFISQLMCDYFFKCMTCKSGIGVFELVDDHFVELNVGVTGLPVSDSRIIAGLVLQKDFSVYRPADGDMRMVIVTETIQP |
Gene Sequence | LEAYFCGRVGRNNHKFISQLMCDYFFKCMTCKSGIGVFELVDDHFVELNVGVTGLPVSDSRIIAGLVLQKDFSVYRPADGDMRMVIVTETIQP |
Gene ID - Mouse | ENSMUSG00000035759 |
Gene ID - Rat | ENSRNOG00000026913 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti BBS10 pAb (ATL-HPA058743) | |
Datasheet | Anti BBS10 pAb (ATL-HPA058743) Datasheet (External Link) |
Vendor Page | Anti BBS10 pAb (ATL-HPA058743) at Atlas Antibodies |
Documents & Links for Anti BBS10 pAb (ATL-HPA058743) | |
Datasheet | Anti BBS10 pAb (ATL-HPA058743) Datasheet (External Link) |
Vendor Page | Anti BBS10 pAb (ATL-HPA058743) |