Anti BBS10 pAb (ATL-HPA058743)

Atlas Antibodies

Catalog No.:
ATL-HPA058743-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: Bardet-Biedl syndrome 10
Gene Name: BBS10
Alternative Gene Name: C12orf58, FLJ23560
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035759: 81%, ENSRNOG00000026913: 78%
Entrez Gene ID: 79738
Uniprot ID: Q8TAM1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LEAYFCGRVGRNNHKFISQLMCDYFFKCMTCKSGIGVFELVDDHFVELNVGVTGLPVSDSRIIAGLVLQKDFSVYRPADGDMRMVIVTETIQP
Gene Sequence LEAYFCGRVGRNNHKFISQLMCDYFFKCMTCKSGIGVFELVDDHFVELNVGVTGLPVSDSRIIAGLVLQKDFSVYRPADGDMRMVIVTETIQP
Gene ID - Mouse ENSMUSG00000035759
Gene ID - Rat ENSRNOG00000026913
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti BBS10 pAb (ATL-HPA058743)
Datasheet Anti BBS10 pAb (ATL-HPA058743) Datasheet (External Link)
Vendor Page Anti BBS10 pAb (ATL-HPA058743) at Atlas Antibodies

Documents & Links for Anti BBS10 pAb (ATL-HPA058743)
Datasheet Anti BBS10 pAb (ATL-HPA058743) Datasheet (External Link)
Vendor Page Anti BBS10 pAb (ATL-HPA058743)