Anti BBS1 pAb (ATL-HPA058283)

Atlas Antibodies

Catalog No.:
ATL-HPA058283-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: Bardet-Biedl syndrome 1
Gene Name: BBS1
Alternative Gene Name: FLJ23590
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000006464: 94%, ENSRNOG00000019832: 94%
Entrez Gene ID: 582
Uniprot ID: Q8NFJ9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen IQSLRFLQLELSEMEAFVNQHKSNSIKRQTVITTMTTLKKNLADEDAVSCLVLGTENKELLVLDPEAFTILAKMSLPSVPVFLEVSGQFDVEFRLA
Gene Sequence IQSLRFLQLELSEMEAFVNQHKSNSIKRQTVITTMTTLKKNLADEDAVSCLVLGTENKELLVLDPEAFTILAKMSLPSVPVFLEVSGQFDVEFRLA
Gene ID - Mouse ENSMUSG00000006464
Gene ID - Rat ENSRNOG00000019832
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti BBS1 pAb (ATL-HPA058283)
Datasheet Anti BBS1 pAb (ATL-HPA058283) Datasheet (External Link)
Vendor Page Anti BBS1 pAb (ATL-HPA058283) at Atlas Antibodies

Documents & Links for Anti BBS1 pAb (ATL-HPA058283)
Datasheet Anti BBS1 pAb (ATL-HPA058283) Datasheet (External Link)
Vendor Page Anti BBS1 pAb (ATL-HPA058283)