Anti BBS1 pAb (ATL-HPA058283)
Atlas Antibodies
- Catalog No.:
- ATL-HPA058283-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: BBS1
Alternative Gene Name: FLJ23590
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000006464: 94%, ENSRNOG00000019832: 94%
Entrez Gene ID: 582
Uniprot ID: Q8NFJ9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | IQSLRFLQLELSEMEAFVNQHKSNSIKRQTVITTMTTLKKNLADEDAVSCLVLGTENKELLVLDPEAFTILAKMSLPSVPVFLEVSGQFDVEFRLA |
| Gene Sequence | IQSLRFLQLELSEMEAFVNQHKSNSIKRQTVITTMTTLKKNLADEDAVSCLVLGTENKELLVLDPEAFTILAKMSLPSVPVFLEVSGQFDVEFRLA |
| Gene ID - Mouse | ENSMUSG00000006464 |
| Gene ID - Rat | ENSRNOG00000019832 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti BBS1 pAb (ATL-HPA058283) | |
| Datasheet | Anti BBS1 pAb (ATL-HPA058283) Datasheet (External Link) |
| Vendor Page | Anti BBS1 pAb (ATL-HPA058283) at Atlas Antibodies |
| Documents & Links for Anti BBS1 pAb (ATL-HPA058283) | |
| Datasheet | Anti BBS1 pAb (ATL-HPA058283) Datasheet (External Link) |
| Vendor Page | Anti BBS1 pAb (ATL-HPA058283) |