Anti BBOX1 pAb (ATL-HPA007600 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA007600-25
  • Immunohistochemistry analysis in human kidney and skeletal muscle tissues using HPA007600 antibody. Corresponding BBOX1 RNA-seq data are presented for the same tissues.
  • Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: butyrobetaine (gamma), 2-oxoglutarate dioxygenase (gamma-butyrobetaine hydroxylase) 1
Gene Name: BBOX1
Alternative Gene Name: BBH, BBOX, G-BBH, gamma-BBH
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041660: 94%, ENSRNOG00000059519: 95%
Entrez Gene ID: 8424
Uniprot ID: O75936
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DANNVAYTTGKLSFHTDYPALHHPPGVQLLHCIKQTVTGGDSEIVDGFNVCQKLKKNNPQAFQILSSTFVDFTDIGVDYCDFSVQSKHKIIELDDKGQVVRINFNNATRDTIFDVPVERVQPFYAALKEFVDLMNSKESKLT
Gene Sequence DANNVAYTTGKLSFHTDYPALHHPPGVQLLHCIKQTVTGGDSEIVDGFNVCQKLKKNNPQAFQILSSTFVDFTDIGVDYCDFSVQSKHKIIELDDKGQVVRINFNNATRDTIFDVPVERVQPFYAALKEFVDLMNSKESKLT
Gene ID - Mouse ENSMUSG00000041660
Gene ID - Rat ENSRNOG00000059519
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti BBOX1 pAb (ATL-HPA007600 w/enhanced validation)
Datasheet Anti BBOX1 pAb (ATL-HPA007600 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti BBOX1 pAb (ATL-HPA007600 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti BBOX1 pAb (ATL-HPA007600 w/enhanced validation)
Datasheet Anti BBOX1 pAb (ATL-HPA007600 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti BBOX1 pAb (ATL-HPA007600 w/enhanced validation)



Citations for Anti BBOX1 pAb (ATL-HPA007600 w/enhanced validation) – 1 Found
van Dijk, Karin D; Berendse, Henk W; Drukarch, Benjamin; Fratantoni, Silvina A; Pham, Thang V; Piersma, Sander R; Huisman, Evelien; Brevé, John J P; Groenewegen, Henk J; Jimenez, Connie R; van de Berg, Wilma D J. The proteome of the locus ceruleus in Parkinson's disease: relevance to pathogenesis. Brain Pathology (Zurich, Switzerland). 2012;22(4):485-98.  PubMed