Anti BBOF1 pAb (ATL-HPA075108)

Atlas Antibodies

Catalog No.: ATL-HPA075108-25

Protein Description: basal body orientation factor 1
Gene Name: BBOF1
Alternative Gene Name: C14orf45, CCDC176
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000057265: 81%, ENSRNOG00000011376: 81%
Entrez Gene ID: 80127
Uniprot ID: Q8ND07
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ERAHHEAIVQLNDAGRNVFKENVYLQKALAYHLKETDALQKNSQKLQESHTLLLHQKEINDLLVKEKIMQLVQQRSQIQTLQKKVVNLETALSYMTKEFESEVLKLQQHAMIENQAGQVEIDKLQHLLQMKDREMNRVKK
• Gene Sequence: ERAHHEAIVQLNDAGRNVFKENVYLQKALAYHLKETDALQKNSQKLQESHTLLLHQKEINDLLVKEKIMQLVQQRSQIQTLQKKVVNLETALSYMTKEFESEVLKLQQHAMIENQAGQVEIDKLQHLLQMKDREMNRVKK
• Gene ID - Mouse: ENSMUSG00000057265
• Gene ID - Rat: ENSRNOG00000011376
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.