Anti BBOF1 pAb (ATL-HPA075108)

Atlas Antibodies

Catalog No.:
ATL-HPA075108-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: basal body orientation factor 1
Gene Name: BBOF1
Alternative Gene Name: C14orf45, CCDC176
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000057265: 81%, ENSRNOG00000011376: 81%
Entrez Gene ID: 80127
Uniprot ID: Q8ND07
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ERAHHEAIVQLNDAGRNVFKENVYLQKALAYHLKETDALQKNSQKLQESHTLLLHQKEINDLLVKEKIMQLVQQRSQIQTLQKKVVNLETALSYMTKEFESEVLKLQQHAMIENQAGQVEIDKLQHLLQMKDREMNRVKK
Gene Sequence ERAHHEAIVQLNDAGRNVFKENVYLQKALAYHLKETDALQKNSQKLQESHTLLLHQKEINDLLVKEKIMQLVQQRSQIQTLQKKVVNLETALSYMTKEFESEVLKLQQHAMIENQAGQVEIDKLQHLLQMKDREMNRVKK
Gene ID - Mouse ENSMUSG00000057265
Gene ID - Rat ENSRNOG00000011376
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti BBOF1 pAb (ATL-HPA075108)
Datasheet Anti BBOF1 pAb (ATL-HPA075108) Datasheet (External Link)
Vendor Page Anti BBOF1 pAb (ATL-HPA075108) at Atlas Antibodies

Documents & Links for Anti BBOF1 pAb (ATL-HPA075108)
Datasheet Anti BBOF1 pAb (ATL-HPA075108) Datasheet (External Link)
Vendor Page Anti BBOF1 pAb (ATL-HPA075108)