Anti BBOF1 pAb (ATL-HPA003090)
Atlas Antibodies
- Catalog No.:
- ATL-HPA003090-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: BBOF1
Alternative Gene Name: C14orf45, CCDC176
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000057265: 77%, ENSRNOG00000011376: 68%
Entrez Gene ID: 80127
Uniprot ID: Q8ND07
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | PGEAKMPSKGKDKKKGKSKGKDTKKLIKTDESVVDRAKANASLWEARLEVTELSRIKYRDTSRILAKSNEDLKKKQCKMEKDIMSVLSYLKKQDQEKDNM |
| Gene Sequence | PGEAKMPSKGKDKKKGKSKGKDTKKLIKTDESVVDRAKANASLWEARLEVTELSRIKYRDTSRILAKSNEDLKKKQCKMEKDIMSVLSYLKKQDQEKDNM |
| Gene ID - Mouse | ENSMUSG00000057265 |
| Gene ID - Rat | ENSRNOG00000011376 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti BBOF1 pAb (ATL-HPA003090) | |
| Datasheet | Anti BBOF1 pAb (ATL-HPA003090) Datasheet (External Link) |
| Vendor Page | Anti BBOF1 pAb (ATL-HPA003090) at Atlas Antibodies |
| Documents & Links for Anti BBOF1 pAb (ATL-HPA003090) | |
| Datasheet | Anti BBOF1 pAb (ATL-HPA003090) Datasheet (External Link) |
| Vendor Page | Anti BBOF1 pAb (ATL-HPA003090) |