Anti BBIP1 pAb (ATL-HPA055206)

Atlas Antibodies

Catalog No.:
ATL-HPA055206-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: BBSome interacting protein 1
Gene Name: BBIP1
Alternative Gene Name: bA348N5.3, BBIP10, BBS18, NCRNA00081
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000084957: 83%, ENSRNOG00000047019: 85%
Entrez Gene ID: 92482
Uniprot ID: A8MTZ0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EVKSMFREVLPKQGPLFVEDIMTMVLCKPKLLPLKSLTLEKLEKMHQAAQNTIRQQEMAEKDQRQ
Gene Sequence EVKSMFREVLPKQGPLFVEDIMTMVLCKPKLLPLKSLTLEKLEKMHQAAQNTIRQQEMAEKDQRQ
Gene ID - Mouse ENSMUSG00000084957
Gene ID - Rat ENSRNOG00000047019
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti BBIP1 pAb (ATL-HPA055206)
Datasheet Anti BBIP1 pAb (ATL-HPA055206) Datasheet (External Link)
Vendor Page Anti BBIP1 pAb (ATL-HPA055206) at Atlas Antibodies

Documents & Links for Anti BBIP1 pAb (ATL-HPA055206)
Datasheet Anti BBIP1 pAb (ATL-HPA055206) Datasheet (External Link)
Vendor Page Anti BBIP1 pAb (ATL-HPA055206)