Anti BAZ1B pAb (ATL-HPA067010)

Atlas Antibodies

Catalog No.:
ATL-HPA067010-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: bromodomain adjacent to zinc finger domain, 1B
Gene Name: BAZ1B
Alternative Gene Name: WBSCR10, WBSCR9, WSTF
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002748: 86%, ENSRNOG00000001453: 86%
Entrez Gene ID: 9031
Uniprot ID: Q9UIG0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RIRKHKAAAEKAFQEGIAKAKLVMRRTPIGTDRNHNRYWLFSDEVPGLFIEKGWVHDSIDYRFNHHCKDHTVSGDE
Gene Sequence RIRKHKAAAEKAFQEGIAKAKLVMRRTPIGTDRNHNRYWLFSDEVPGLFIEKGWVHDSIDYRFNHHCKDHTVSGDE
Gene ID - Mouse ENSMUSG00000002748
Gene ID - Rat ENSRNOG00000001453
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti BAZ1B pAb (ATL-HPA067010)
Datasheet Anti BAZ1B pAb (ATL-HPA067010) Datasheet (External Link)
Vendor Page Anti BAZ1B pAb (ATL-HPA067010) at Atlas Antibodies

Documents & Links for Anti BAZ1B pAb (ATL-HPA067010)
Datasheet Anti BAZ1B pAb (ATL-HPA067010) Datasheet (External Link)
Vendor Page Anti BAZ1B pAb (ATL-HPA067010)