Anti BAZ1B pAb (ATL-HPA067010)

Atlas Antibodies

SKU: ATL-HPA067010-25

• 

Protein Description: bromodomain adjacent to zinc finger domain, 1B
Gene Name: BAZ1B
Alternative Gene Name: WBSCR10, WBSCR9, WSTF
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002748: 86%, ENSRNOG00000001453: 86%
Entrez Gene ID: 9031
Uniprot ID: Q9UIG0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RIRKHKAAAEKAFQEGIAKAKLVMRRTPIGTDRNHNRYWLFSDEVPGLFIEKGWVHDSIDYRFNHHCKDHTVSGDE
• Gene Sequence: RIRKHKAAAEKAFQEGIAKAKLVMRRTPIGTDRNHNRYWLFSDEVPGLFIEKGWVHDSIDYRFNHHCKDHTVSGDE
• Gene ID - Mouse: ENSMUSG00000002748
• Gene ID - Rat: ENSRNOG00000001453
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.