Anti BAZ1B pAb (ATL-HPA067010)
Atlas Antibodies
- SKU:
- ATL-HPA067010-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: BAZ1B
Alternative Gene Name: WBSCR10, WBSCR9, WSTF
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002748: 86%, ENSRNOG00000001453: 86%
Entrez Gene ID: 9031
Uniprot ID: Q9UIG0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | RIRKHKAAAEKAFQEGIAKAKLVMRRTPIGTDRNHNRYWLFSDEVPGLFIEKGWVHDSIDYRFNHHCKDHTVSGDE |
Gene Sequence | RIRKHKAAAEKAFQEGIAKAKLVMRRTPIGTDRNHNRYWLFSDEVPGLFIEKGWVHDSIDYRFNHHCKDHTVSGDE |
Gene ID - Mouse | ENSMUSG00000002748 |
Gene ID - Rat | ENSRNOG00000001453 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti BAZ1B pAb (ATL-HPA067010) | |
Datasheet | Anti BAZ1B pAb (ATL-HPA067010) Datasheet (External Link) |
Vendor Page | Anti BAZ1B pAb (ATL-HPA067010) at Atlas Antibodies |
Documents & Links for Anti BAZ1B pAb (ATL-HPA067010) | |
Datasheet | Anti BAZ1B pAb (ATL-HPA067010) Datasheet (External Link) |
Vendor Page | Anti BAZ1B pAb (ATL-HPA067010) |