Anti BAX pAb (ATL-HPA027878 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA027878-25

• 
• 

Protein Description: BCL2-associated X protein
Gene Name: BAX
Alternative Gene Name: BCL2L4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003873: 90%, ENSRNOG00000020876: 88%
Entrez Gene ID: 581
Uniprot ID: Q07812
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNW
• Gene Sequence: GPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNW
• Gene ID - Mouse: ENSMUSG00000003873
• Gene ID - Rat: ENSRNOG00000020876
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti BAX pAb (ATL-HPA027878 w/enhanced validation) – 3 Found

Forika, Gertrud; Kiss, Eva; Petovari, Gabor; Danko, Titanilla; Gellert, Aron Bertram; Krenacs, Tibor. Modulated Electro-Hyperthermia Supports the Effect of Gemcitabine Both in Sensitive and Resistant Pancreas Adenocarcinoma Cell Lines. Pathology Oncology Research : Por. 27( 34955688):1610048. 

Mahmoud, Mona F; Ali, Noura; Mostafa, Islam; Hasan, Rehab A; Sobeh, Mansour. Coriander Oil Reverses Dexamethasone-Induced Insulin Resistance in Rats. Antioxidants (Basel, Switzerland). 2022;11(3) 

Turunen, S Pauliina; von Nandelstadh, Pernilla; Öhman, Tiina; Gucciardo, Erika; Seashore-Ludlow, Brinton; Martins, Beatriz; Rantanen, Ville; Li, Huini; Höpfner, Katrin; Östling, Päivi; Varjosalo, Markku; Lehti, Kaisa. FGFR4 phosphorylates MST1 to confer breast cancer cells resistance to MST1/2-dependent apoptosis. Cell Death And Differentiation. 2019;26(12):2577-2593.