Anti BATF pAb (ATL-HPA064962)

Atlas Antibodies

Catalog No.:
ATL-HPA064962-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: basic leucine zipper transcription factor, ATF-like
Gene Name: BATF
Alternative Gene Name: B-ATF, BATF1, SFA-2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034266: 91%, ENSRNOG00000008588: 91%
Entrez Gene ID: 10538
Uniprot ID: Q16520
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TEELKYFTSVLNSHEPLCSVLAASTPSPPEVVYSAHAFHQPHV
Gene Sequence TEELKYFTSVLNSHEPLCSVLAASTPSPPEVVYSAHAFHQPHV
Gene ID - Mouse ENSMUSG00000034266
Gene ID - Rat ENSRNOG00000008588
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti BATF pAb (ATL-HPA064962)
Datasheet Anti BATF pAb (ATL-HPA064962) Datasheet (External Link)
Vendor Page Anti BATF pAb (ATL-HPA064962) at Atlas Antibodies

Documents & Links for Anti BATF pAb (ATL-HPA064962)
Datasheet Anti BATF pAb (ATL-HPA064962) Datasheet (External Link)
Vendor Page Anti BATF pAb (ATL-HPA064962)