Anti BATF pAb (ATL-HPA059588)
Atlas Antibodies
- Catalog No.:
- ATL-HPA059588-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: BATF
Alternative Gene Name: B-ATF, BATF1, SFA-2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034266: 97%, ENSRNOG00000008588: 97%
Entrez Gene ID: 10538
Uniprot ID: Q16520
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | DSSDSSFSRSPPPGKQDSSDDVRRVQRREK |
| Gene Sequence | DSSDSSFSRSPPPGKQDSSDDVRRVQRREK |
| Gene ID - Mouse | ENSMUSG00000034266 |
| Gene ID - Rat | ENSRNOG00000008588 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti BATF pAb (ATL-HPA059588) | |
| Datasheet | Anti BATF pAb (ATL-HPA059588) Datasheet (External Link) |
| Vendor Page | Anti BATF pAb (ATL-HPA059588) at Atlas Antibodies |
| Documents & Links for Anti BATF pAb (ATL-HPA059588) | |
| Datasheet | Anti BATF pAb (ATL-HPA059588) Datasheet (External Link) |
| Vendor Page | Anti BATF pAb (ATL-HPA059588) |