Anti BASP1 pAb (ATL-HPA045218 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA045218-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: brain abundant, membrane attached signal protein 1
Gene Name: BASP1
Alternative Gene Name: CAP-23, CAP23, NAP-22, NAP22
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045763: 95%, ENSRNOG00000046313: 93%
Entrez Gene ID: 10409
Uniprot ID: P80723
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MGGKLSKKKKGYNVNDEKAKEKDKKAEGAATEEEGTPKESEP
Gene Sequence MGGKLSKKKKGYNVNDEKAKEKDKKAEGAATEEEGTPKESEP
Gene ID - Mouse ENSMUSG00000045763
Gene ID - Rat ENSRNOG00000046313
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti BASP1 pAb (ATL-HPA045218 w/enhanced validation)
Datasheet Anti BASP1 pAb (ATL-HPA045218 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti BASP1 pAb (ATL-HPA045218 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti BASP1 pAb (ATL-HPA045218 w/enhanced validation)
Datasheet Anti BASP1 pAb (ATL-HPA045218 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti BASP1 pAb (ATL-HPA045218 w/enhanced validation)
Citations for Anti BASP1 pAb (ATL-HPA045218 w/enhanced validation) – 1 Found
Zhou, Qimin; Andersson, Roland; Hu, Dingyuan; Bauden, Monika; Kristl, Theresa; Sasor, Agata; Pawłowski, Krzysztof; Pla, Indira; Hilmersson, Katarzyna Said; Zhou, Mengtao; Lu, Fan; Marko-Varga, György; Ansari, Daniel. Quantitative proteomics identifies brain acid soluble protein 1 (BASP1) as a prognostic biomarker candidate in pancreatic cancer tissue. Ebiomedicine. 2019;43( 30982764):282-294.  PubMed