Anti BASP1 pAb (ATL-HPA045218 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA045218-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: BASP1
Alternative Gene Name: CAP-23, CAP23, NAP-22, NAP22
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045763: 95%, ENSRNOG00000046313: 93%
Entrez Gene ID: 10409
Uniprot ID: P80723
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MGGKLSKKKKGYNVNDEKAKEKDKKAEGAATEEEGTPKESEP |
| Gene Sequence | MGGKLSKKKKGYNVNDEKAKEKDKKAEGAATEEEGTPKESEP |
| Gene ID - Mouse | ENSMUSG00000045763 |
| Gene ID - Rat | ENSRNOG00000046313 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti BASP1 pAb (ATL-HPA045218 w/enhanced validation) | |
| Datasheet | Anti BASP1 pAb (ATL-HPA045218 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti BASP1 pAb (ATL-HPA045218 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti BASP1 pAb (ATL-HPA045218 w/enhanced validation) | |
| Datasheet | Anti BASP1 pAb (ATL-HPA045218 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti BASP1 pAb (ATL-HPA045218 w/enhanced validation) |
| Citations for Anti BASP1 pAb (ATL-HPA045218 w/enhanced validation) – 1 Found |
| Zhou, Qimin; Andersson, Roland; Hu, Dingyuan; Bauden, Monika; Kristl, Theresa; Sasor, Agata; Pawłowski, Krzysztof; Pla, Indira; Hilmersson, Katarzyna Said; Zhou, Mengtao; Lu, Fan; Marko-Varga, György; Ansari, Daniel. Quantitative proteomics identifies brain acid soluble protein 1 (BASP1) as a prognostic biomarker candidate in pancreatic cancer tissue. Ebiomedicine. 2019;43( 30982764):282-294. PubMed |