Anti BARX2 pAb (ATL-HPA068414)

Atlas Antibodies

Catalog No.:
ATL-HPA068414-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: BARX homeobox 2
Gene Name: BARX2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032033: 72%, ENSRNOG00000008592: 73%
Entrez Gene ID: 8538
Uniprot ID: Q9UMQ3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TSEEIEAEEKMNSQAQGQEQLEPSQGQEELCEAQEPKARDVPLEMAEPPDPPQELPIPSS
Gene Sequence TSEEIEAEEKMNSQAQGQEQLEPSQGQEELCEAQEPKARDVPLEMAEPPDPPQELPIPSS
Gene ID - Mouse ENSMUSG00000032033
Gene ID - Rat ENSRNOG00000008592
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti BARX2 pAb (ATL-HPA068414)
Datasheet Anti BARX2 pAb (ATL-HPA068414) Datasheet (External Link)
Vendor Page Anti BARX2 pAb (ATL-HPA068414) at Atlas Antibodies

Documents & Links for Anti BARX2 pAb (ATL-HPA068414)
Datasheet Anti BARX2 pAb (ATL-HPA068414) Datasheet (External Link)
Vendor Page Anti BARX2 pAb (ATL-HPA068414)