Anti BARHL1 pAb (ATL-HPA004809)
Atlas Antibodies
- Catalog No.:
- ATL-HPA004809-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: BARHL1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026805: 96%, ENSRNOG00000013209: 96%
Entrez Gene ID: 56751
Uniprot ID: Q9BZE3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC, ChIP |
| Reactivity | Human, Mouse |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LELSPRSESSSDCSSPASPGRDCLETGTPRPGGASGPGLDSHLQPGQLSAPAQSRTVTSSFLIRDILADCKPLAACAPYSSSGQPAAPEPGGRLAAKAAEDFRDKLDKSGSNASSDSEYKVKEEGDREISSSRDSP |
| Gene Sequence | LELSPRSESSSDCSSPASPGRDCLETGTPRPGGASGPGLDSHLQPGQLSAPAQSRTVTSSFLIRDILADCKPLAACAPYSSSGQPAAPEPGGRLAAKAAEDFRDKLDKSGSNASSDSEYKVKEEGDREISSSRDSP |
| Gene ID - Mouse | ENSMUSG00000026805 |
| Gene ID - Rat | ENSRNOG00000013209 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti BARHL1 pAb (ATL-HPA004809) | |
| Datasheet | Anti BARHL1 pAb (ATL-HPA004809) Datasheet (External Link) |
| Vendor Page | Anti BARHL1 pAb (ATL-HPA004809) at Atlas Antibodies |
| Documents & Links for Anti BARHL1 pAb (ATL-HPA004809) | |
| Datasheet | Anti BARHL1 pAb (ATL-HPA004809) Datasheet (External Link) |
| Vendor Page | Anti BARHL1 pAb (ATL-HPA004809) |
| Citations for Anti BARHL1 pAb (ATL-HPA004809) – 4 Found |
| Barh, Debmalya; García-Solano, María E; Tiwari, Sandeep; Bhattacharya, Antaripa; Jain, Neha; Torres-Moreno, Daniel; Ferri, Belén; Silva, Artur; Azevedo, Vasco; Ghosh, Preetam; Blum, Kenneth; Conesa-Zamora, Pablo; Perry, George. BARHL1 Is Downregulated in Alzheimer's Disease and May Regulate Cognitive Functions through ESR1 and Multiple Pathways. Genes. 2017;8(10) PubMed |
| Ballabio, Claudio; Anderle, Marica; Gianesello, Matteo; Lago, Chiara; Miele, Evelina; Cardano, Marina; Aiello, Giuseppe; Piazza, Silvano; Caron, Davide; Gianno, Francesca; Ciolfi, Andrea; Pedace, Lucia; Mastronuzzi, Angela; Tartaglia, Marco; Locatelli, Franco; Ferretti, Elisabetta; Giangaspero, Felice; Tiberi, Luca. Modeling medulloblastoma in vivo and with human cerebellar organoids. Nature Communications. 2020;11(1):583. PubMed |
| Zhu, Yan; Hirata, Tatsumi; Mackay, Fabienne; Murakami, Fujio. Chemokine receptor CXCR7 non-cell-autonomously controls pontine neuronal migration and nucleus formation. Scientific Reports. 2020;10(1):11830. PubMed |
| Ofek, Shai; Wiszniak, Sophie; Kagan, Sarah; Tondl, Markus; Schwarz, Quenten; Kalcheim, Chaya. Notch signaling is a critical initiator of roof plate formation as revealed by the use of RNA profiling of the dorsal neural tube. Bmc Biology. 2021;19(1):84. PubMed |