Anti BAP1 pAb (ATL-HPA055560)

Atlas Antibodies

Catalog No.:
ATL-HPA055560-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: BRCA1 associated protein-1 (ubiquitin carboxy-terminal hydrolase)
Gene Name: BAP1
Alternative Gene Name: hucep-6, KIAA0272, UCHL2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021901: 87%, ENSRNOG00000019097: 89%
Entrez Gene ID: 8314
Uniprot ID: Q92560
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PVTSHISKVLFGEDDSLLRVDCIRYNRAVRDLGPVISTGLLHLAEDGVLSPLALTEGGKGSSPSIRPIQGSQGSSSPVEKEVVEATDSREKTGMV
Gene Sequence PVTSHISKVLFGEDDSLLRVDCIRYNRAVRDLGPVISTGLLHLAEDGVLSPLALTEGGKGSSPSIRPIQGSQGSSSPVEKEVVEATDSREKTGMV
Gene ID - Mouse ENSMUSG00000021901
Gene ID - Rat ENSRNOG00000019097
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti BAP1 pAb (ATL-HPA055560)
Datasheet Anti BAP1 pAb (ATL-HPA055560) Datasheet (External Link)
Vendor Page Anti BAP1 pAb (ATL-HPA055560) at Atlas Antibodies

Documents & Links for Anti BAP1 pAb (ATL-HPA055560)
Datasheet Anti BAP1 pAb (ATL-HPA055560) Datasheet (External Link)
Vendor Page Anti BAP1 pAb (ATL-HPA055560)