Anti BANF1 pAb (ATL-HPA039242 w/enhanced validation)
Atlas Antibodies
- SKU:
- ATL-HPA039242-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: BANF1
Alternative Gene Name: BAF
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024844: 96%, ENSRNOG00000020460: 96%
Entrez Gene ID: 8815
Uniprot ID: O75531
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | MTTSQKHRDFVAEPMGEKPVGSLAGIGEVLGKKLEERGFDKAYVVLGQFLVLKKDEDLFREWLKDTCGANAKQSRDCFGC |
Gene Sequence | MTTSQKHRDFVAEPMGEKPVGSLAGIGEVLGKKLEERGFDKAYVVLGQFLVLKKDEDLFREWLKDTCGANAKQSRDCFGC |
Gene ID - Mouse | ENSMUSG00000024844 |
Gene ID - Rat | ENSRNOG00000020460 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti BANF1 pAb (ATL-HPA039242 w/enhanced validation) | |
Datasheet | Anti BANF1 pAb (ATL-HPA039242 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti BANF1 pAb (ATL-HPA039242 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti BANF1 pAb (ATL-HPA039242 w/enhanced validation) | |
Datasheet | Anti BANF1 pAb (ATL-HPA039242 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti BANF1 pAb (ATL-HPA039242 w/enhanced validation) |
Citations for Anti BANF1 pAb (ATL-HPA039242 w/enhanced validation) – 1 Found |
Linville, Alexandria C; Rico, Amber B; Teague, Helena; Binsted, Lucy E; Smith, Geoffrey L; Albarnaz, Jonas D; Wiebe, Matthew S. Dysregulation of Cellular VRK1, BAF, and Innate Immune Signaling by the Vaccinia Virus B12 Pseudokinase. Journal Of Virology. 2022;96(11):e0039822. PubMed |