Anti BANF1 pAb (ATL-HPA039242 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA039242-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: barrier to autointegration factor 1
Gene Name: BANF1
Alternative Gene Name: BAF
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024844: 96%, ENSRNOG00000020460: 96%
Entrez Gene ID: 8815
Uniprot ID: O75531
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC, ChIP
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MTTSQKHRDFVAEPMGEKPVGSLAGIGEVLGKKLEERGFDKAYVVLGQFLVLKKDEDLFREWLKDTCGANAKQSRDCFGC
Gene Sequence MTTSQKHRDFVAEPMGEKPVGSLAGIGEVLGKKLEERGFDKAYVVLGQFLVLKKDEDLFREWLKDTCGANAKQSRDCFGC
Gene ID - Mouse ENSMUSG00000024844
Gene ID - Rat ENSRNOG00000020460
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti BANF1 pAb (ATL-HPA039242 w/enhanced validation)
Datasheet Anti BANF1 pAb (ATL-HPA039242 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti BANF1 pAb (ATL-HPA039242 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti BANF1 pAb (ATL-HPA039242 w/enhanced validation)
Datasheet Anti BANF1 pAb (ATL-HPA039242 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti BANF1 pAb (ATL-HPA039242 w/enhanced validation)
Citations for Anti BANF1 pAb (ATL-HPA039242 w/enhanced validation) – 1 Found
Linville, Alexandria C; Rico, Amber B; Teague, Helena; Binsted, Lucy E; Smith, Geoffrey L; Albarnaz, Jonas D; Wiebe, Matthew S. Dysregulation of Cellular VRK1, BAF, and Innate Immune Signaling by the Vaccinia Virus B12 Pseudokinase. Journal Of Virology. 2022;96(11):e0039822.  PubMed