Anti BAIAP2L2 pAb (ATL-HPA003043)
Atlas Antibodies
- Catalog No.:
- ATL-HPA003043-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: BAIAP2L2
Alternative Gene Name: FLJ22582
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018126: 84%, ENSRNOG00000012215: 82%
Entrez Gene ID: 80115
Uniprot ID: Q6UXY1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | VVEVLVPEAQNGWLYGKLEGSSASGWFPEAYVKALEEGPVNPMTPVTPMTSMTSMSPMTPMNPGNELPSRSYPLRGSHSLDDLLDRPGNSIAPSEYWDGQSRSRTPSRVPSRAPSPAPPPLPSSRRSSMGSTAVATDVKKLMSSEQYPP |
Gene Sequence | VVEVLVPEAQNGWLYGKLEGSSASGWFPEAYVKALEEGPVNPMTPVTPMTSMTSMSPMTPMNPGNELPSRSYPLRGSHSLDDLLDRPGNSIAPSEYWDGQSRSRTPSRVPSRAPSPAPPPLPSSRRSSMGSTAVATDVKKLMSSEQYPP |
Gene ID - Mouse | ENSMUSG00000018126 |
Gene ID - Rat | ENSRNOG00000012215 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti BAIAP2L2 pAb (ATL-HPA003043) | |
Datasheet | Anti BAIAP2L2 pAb (ATL-HPA003043) Datasheet (External Link) |
Vendor Page | Anti BAIAP2L2 pAb (ATL-HPA003043) at Atlas Antibodies |
Documents & Links for Anti BAIAP2L2 pAb (ATL-HPA003043) | |
Datasheet | Anti BAIAP2L2 pAb (ATL-HPA003043) Datasheet (External Link) |
Vendor Page | Anti BAIAP2L2 pAb (ATL-HPA003043) |
Citations for Anti BAIAP2L2 pAb (ATL-HPA003043) – 5 Found |
Halford, Julia; Bateschell, Michael; Barr-Gillespie, Peter G. Ca(2+) entry through mechanotransduction channels localizes BAIAP2L2 to stereocilia tips. Molecular Biology Of The Cell. 2022;33(4):br6. PubMed |
Yan, Keji; Qu, Chengli; Wang, Yanfei; Zong, Wen; Xu, Zhigang. BAIAP2L2 Inactivation Does Not Affect Stereocilia Development or Maintenance in Vestibular Hair Cells. Frontiers In Molecular Neuroscience. 15( 35242013):829204. PubMed |
Pykäläinen, Anette; Boczkowska, Malgorzata; Zhao, Hongxia; Saarikangas, Juha; Rebowski, Grzegorz; Jansen, Maurice; Hakanen, Janne; Koskela, Essi V; Peränen, Johan; Vihinen, Helena; Jokitalo, Eija; Salminen, Marjo; Ikonen, Elina; Dominguez, Roberto; Lappalainen, Pekka. Pinkbar is an epithelial-specific BAR domain protein that generates planar membrane structures. Nature Structural & Molecular Biology. 2011;18(8):902-7. PubMed |
Carlton, Adam J; Halford, Julia; Underhill, Anna; Jeng, Jing-Yi; Avenarius, Matthew R; Gilbert, Merle L; Ceriani, Federico; Ebisine, Kimimuepigha; Brown, Steve D M; Bowl, Michael R; Barr-Gillespie, Peter G; Marcotti, Walter. Loss of Baiap2l2 destabilizes the transducing stereocilia of cochlear hair cells and leads to deafness. The Journal Of Physiology. 2021;599(4):1173-1198. PubMed |
Jeng, Jing-Yi; Carlton, Adam J; Goodyear, Richard J; Chinowsky, Colbie; Ceriani, Federico; Johnson, Stuart L; Sung, Tsung-Chang; Dayn, Yelena; Richardson, Guy P; Bowl, Michael R; Brown, Steve D M; Manor, Uri; Marcotti, Walter. AAV-mediated rescue of Eps8 expression in vivo restores hair-cell function in a mouse model of recessive deafness. Molecular Therapy. Methods & Clinical Development. 2022;26( 36034774):355-370. PubMed |