Anti BAIAP2L2 pAb (ATL-HPA003043)

Atlas Antibodies

SKU: ATL-HPA003043-25

• 

Protein Description: BAI1-associated protein 2-like 2
Gene Name: BAIAP2L2
Alternative Gene Name: FLJ22582
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018126: 84%, ENSRNOG00000012215: 82%
Entrez Gene ID: 80115
Uniprot ID: Q6UXY1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VVEVLVPEAQNGWLYGKLEGSSASGWFPEAYVKALEEGPVNPMTPVTPMTSMTSMSPMTPMNPGNELPSRSYPLRGSHSLDDLLDRPGNSIAPSEYWDGQSRSRTPSRVPSRAPSPAPPPLPSSRRSSMGSTAVATDVKKLMSSEQYPP
• Gene Sequence: VVEVLVPEAQNGWLYGKLEGSSASGWFPEAYVKALEEGPVNPMTPVTPMTSMTSMSPMTPMNPGNELPSRSYPLRGSHSLDDLLDRPGNSIAPSEYWDGQSRSRTPSRVPSRAPSPAPPPLPSSRRSSMGSTAVATDVKKLMSSEQYPP
• Gene ID - Mouse: ENSMUSG00000018126
• Gene ID - Rat: ENSRNOG00000012215
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti BAIAP2L2 pAb (ATL-HPA003043) – 5 Found

Halford, Julia; Bateschell, Michael; Barr-Gillespie, Peter G. Ca(2+) entry through mechanotransduction channels localizes BAIAP2L2 to stereocilia tips. Molecular Biology Of The Cell. 2022;33(4):br6. 

Yan, Keji; Qu, Chengli; Wang, Yanfei; Zong, Wen; Xu, Zhigang. BAIAP2L2 Inactivation Does Not Affect Stereocilia Development or Maintenance in Vestibular Hair Cells. Frontiers In Molecular Neuroscience. 15( 35242013):829204. 

Pykäläinen, Anette; Boczkowska, Malgorzata; Zhao, Hongxia; Saarikangas, Juha; Rebowski, Grzegorz; Jansen, Maurice; Hakanen, Janne; Koskela, Essi V; Peränen, Johan; Vihinen, Helena; Jokitalo, Eija; Salminen, Marjo; Ikonen, Elina; Dominguez, Roberto; Lappalainen, Pekka. Pinkbar is an epithelial-specific BAR domain protein that generates planar membrane structures. Nature Structural & Molecular Biology. 2011;18(8):902-7. 

Carlton, Adam J; Halford, Julia; Underhill, Anna; Jeng, Jing-Yi; Avenarius, Matthew R; Gilbert, Merle L; Ceriani, Federico; Ebisine, Kimimuepigha; Brown, Steve D M; Bowl, Michael R; Barr-Gillespie, Peter G; Marcotti, Walter. Loss of Baiap2l2 destabilizes the transducing stereocilia of cochlear hair cells and leads to deafness. The Journal Of Physiology. 2021;599(4):1173-1198. 

Jeng, Jing-Yi; Carlton, Adam J; Goodyear, Richard J; Chinowsky, Colbie; Ceriani, Federico; Johnson, Stuart L; Sung, Tsung-Chang; Dayn, Yelena; Richardson, Guy P; Bowl, Michael R; Brown, Steve D M; Manor, Uri; Marcotti, Walter. AAV-mediated rescue of Eps8 expression in vivo restores hair-cell function in a mouse model of recessive deafness. Molecular Therapy. Methods & Clinical Development. 2022;26( 36034774):355-370.