Anti BAIAP2L1 pAb (ATL-HPA029503 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA029503-100
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: BAI1-associated protein 2-like 1
Gene Name: BAIAP2L1
Alternative Gene Name: IRTKS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038859: 91%, ENSRNOG00000001007: 90%
Entrez Gene ID: 55971
Uniprot ID: Q9UHR4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human, Rat
Clonality Polyclonal
Host Rabbit
Immunogen EEKRRFCFLVDKHCGFANHIHYYHLQSAELLNSKLPRWQETCVDAIKVPEKIMNMIEEIKTPASTPVSGTPQASPMI
Gene Sequence EEKRRFCFLVDKHCGFANHIHYYHLQSAELLNSKLPRWQETCVDAIKVPEKIMNMIEEIKTPASTPVSGTPQASPMI
Gene ID - Mouse ENSMUSG00000038859
Gene ID - Rat ENSRNOG00000001007
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti BAIAP2L1 pAb (ATL-HPA029503 w/enhanced validation)
Datasheet Anti BAIAP2L1 pAb (ATL-HPA029503 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti BAIAP2L1 pAb (ATL-HPA029503 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti BAIAP2L1 pAb (ATL-HPA029503 w/enhanced validation)
Datasheet Anti BAIAP2L1 pAb (ATL-HPA029503 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti BAIAP2L1 pAb (ATL-HPA029503 w/enhanced validation)