Anti BAIAP2L1 pAb (ATL-HPA023874 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA023874-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: BAIAP2L1
Alternative Gene Name: IRTKS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038859: 71%, ENSRNOG00000001007: 75%
Entrez Gene ID: 55971
Uniprot ID: Q9UHR4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | DYLECLSMGAAADRRADSARTTSTFKAPASKPETAAPNDANGTAKPPFLSGENPFATVKLRPTVTNDRSAP |
| Gene Sequence | DYLECLSMGAAADRRADSARTTSTFKAPASKPETAAPNDANGTAKPPFLSGENPFATVKLRPTVTNDRSAP |
| Gene ID - Mouse | ENSMUSG00000038859 |
| Gene ID - Rat | ENSRNOG00000001007 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti BAIAP2L1 pAb (ATL-HPA023874 w/enhanced validation) | |
| Datasheet | Anti BAIAP2L1 pAb (ATL-HPA023874 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti BAIAP2L1 pAb (ATL-HPA023874 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti BAIAP2L1 pAb (ATL-HPA023874 w/enhanced validation) | |
| Datasheet | Anti BAIAP2L1 pAb (ATL-HPA023874 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti BAIAP2L1 pAb (ATL-HPA023874 w/enhanced validation) |