Anti BAIAP2L1 pAb (ATL-HPA021257 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA021257-25

• 
• 
• 

Protein Description: BAI1-associated protein 2-like 1
Gene Name: BAIAP2L1
Alternative Gene Name: IRTKS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038859: 85%, ENSRNOG00000001007: 82%
Entrez Gene ID: 55971
Uniprot ID: Q9UHR4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LLSFAQGDVITLLIPEEKDGWLYGEHDVSKARGWFPSSYTKLLEENETEAVTVPTPSPTPVRSISTVNLSEN
• Gene Sequence: LLSFAQGDVITLLIPEEKDGWLYGEHDVSKARGWFPSSYTKLLEENETEAVTVPTPSPTPVRSISTVNLSEN
• Gene ID - Mouse: ENSMUSG00000038859
• Gene ID - Rat: ENSRNOG00000001007
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti BAIAP2L1 pAb (ATL-HPA021257 w/enhanced validation) – 1 Found

Postema, Meagan M; Grega-Larson, Nathan E; Neininger, Abigail C; Tyska, Matthew J. IRTKS (BAIAP2L1) Elongates Epithelial Microvilli Using EPS8-Dependent and Independent Mechanisms. Current Biology : Cb. 2018;28(18):2876-2888.e4.