Anti BAIAP2L1 pAb (ATL-HPA019484 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA019484-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: BAI1-associated protein 2-like 1
Gene Name: BAIAP2L1
Alternative Gene Name: IRTKS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038859: 83%, ENSRNOG00000001007: 79%
Entrez Gene ID: 55971
Uniprot ID: Q9UHR4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen ERSNVVRKDYDTLSKCSPKMPPAPSGRAYTSPLIDMFNNPATAAPNSQRVNNSTGTSEDPSLQRSVSVATGLNMMKKQKVKTIFPHTAGSN
Gene Sequence ERSNVVRKDYDTLSKCSPKMPPAPSGRAYTSPLIDMFNNPATAAPNSQRVNNSTGTSEDPSLQRSVSVATGLNMMKKQKVKTIFPHTAGSN
Gene ID - Mouse ENSMUSG00000038859
Gene ID - Rat ENSRNOG00000001007
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti BAIAP2L1 pAb (ATL-HPA019484 w/enhanced validation)
Datasheet Anti BAIAP2L1 pAb (ATL-HPA019484 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti BAIAP2L1 pAb (ATL-HPA019484 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti BAIAP2L1 pAb (ATL-HPA019484 w/enhanced validation)
Datasheet Anti BAIAP2L1 pAb (ATL-HPA019484 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti BAIAP2L1 pAb (ATL-HPA019484 w/enhanced validation)
Citations for Anti BAIAP2L1 pAb (ATL-HPA019484 w/enhanced validation) – 1 Found
Chou, Ai Mei; Sem, Kai Ping; Lam, Wei Jun; Ahmed, Sohail; Lim, Chin Yan. Redundant functions of I-BAR family members, IRSp53 and IRTKS, are essential for embryonic development. Scientific Reports. 2017;7( 28067313):40485.  PubMed