Anti BAIAP2 pAb (ATL-HPA027421 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA027421-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: BAIAP2
Alternative Gene Name: BAP2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025372: 93%, ENSRNOG00000004049: 92%
Entrez Gene ID: 10458
Uniprot ID: Q9UQB8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human, Mouse, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | AYHSKGKELLAQKLPLWQQACADPSKIPERAVQLMQQVASNGATLPSALSASKSNLVISDPIPGAKPLPVPPELAPFVGRMSAQE |
| Gene Sequence | AYHSKGKELLAQKLPLWQQACADPSKIPERAVQLMQQVASNGATLPSALSASKSNLVISDPIPGAKPLPVPPELAPFVGRMSAQE |
| Gene ID - Mouse | ENSMUSG00000025372 |
| Gene ID - Rat | ENSRNOG00000004049 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti BAIAP2 pAb (ATL-HPA027421 w/enhanced validation) | |
| Datasheet | Anti BAIAP2 pAb (ATL-HPA027421 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti BAIAP2 pAb (ATL-HPA027421 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti BAIAP2 pAb (ATL-HPA027421 w/enhanced validation) | |
| Datasheet | Anti BAIAP2 pAb (ATL-HPA027421 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti BAIAP2 pAb (ATL-HPA027421 w/enhanced validation) |
| Citations for Anti BAIAP2 pAb (ATL-HPA027421 w/enhanced validation) – 1 Found |
| Wu, Chien-Ting; Lidsky, Peter V; Xiao, Yinghong; Cheng, Ran; Lee, Ivan T; Nakayama, Tsuguhisa; Jiang, Sizun; He, Wei; Demeter, Janos; Knight, Miguel G; Turn, Rachel E; Rojas-Hernandez, Laura S; Ye, Chengjin; Chiem, Kevin; Shon, Judy; Martinez-Sobrido, Luis; Bertozzi, Carolyn R; Nolan, Garry P; Nayak, Jayakar V; Milla, Carlos; Andino, Raul; Jackson, Peter K. SARS-CoV-2 replication in airway epithelia requires motile cilia and microvillar reprogramming. Cell. 2023;186(1):112-130.e20. PubMed |