Anti BAIAP2 pAb (ATL-HPA027421 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA027421-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: BAI1-associated protein 2
Gene Name: BAIAP2
Alternative Gene Name: BAP2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025372: 93%, ENSRNOG00000004049: 92%
Entrez Gene ID: 10458
Uniprot ID: Q9UQB8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen AYHSKGKELLAQKLPLWQQACADPSKIPERAVQLMQQVASNGATLPSALSASKSNLVISDPIPGAKPLPVPPELAPFVGRMSAQE
Gene Sequence AYHSKGKELLAQKLPLWQQACADPSKIPERAVQLMQQVASNGATLPSALSASKSNLVISDPIPGAKPLPVPPELAPFVGRMSAQE
Gene ID - Mouse ENSMUSG00000025372
Gene ID - Rat ENSRNOG00000004049
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti BAIAP2 pAb (ATL-HPA027421 w/enhanced validation)
Datasheet Anti BAIAP2 pAb (ATL-HPA027421 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti BAIAP2 pAb (ATL-HPA027421 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti BAIAP2 pAb (ATL-HPA027421 w/enhanced validation)
Datasheet Anti BAIAP2 pAb (ATL-HPA027421 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti BAIAP2 pAb (ATL-HPA027421 w/enhanced validation)
Citations for Anti BAIAP2 pAb (ATL-HPA027421 w/enhanced validation) – 1 Found
Wu, Chien-Ting; Lidsky, Peter V; Xiao, Yinghong; Cheng, Ran; Lee, Ivan T; Nakayama, Tsuguhisa; Jiang, Sizun; He, Wei; Demeter, Janos; Knight, Miguel G; Turn, Rachel E; Rojas-Hernandez, Laura S; Ye, Chengjin; Chiem, Kevin; Shon, Judy; Martinez-Sobrido, Luis; Bertozzi, Carolyn R; Nolan, Garry P; Nayak, Jayakar V; Milla, Carlos; Andino, Raul; Jackson, Peter K. SARS-CoV-2 replication in airway epithelia requires motile cilia and microvillar reprogramming. Cell. 2023;186(1):112-130.e20.  PubMed