Anti BAIAP2 pAb (ATL-HPA023310 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA023310-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: BAI1-associated protein 2
Gene Name: BAIAP2
Alternative Gene Name: BAP2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025372: 92%, ENSRNOG00000004049: 92%
Entrez Gene ID: 10458
Uniprot ID: Q9UQB8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human, Rat
Clonality Polyclonal
Host Rabbit
Immunogen WFPFSYTRVLDSDGSDRLHMSLQQGKSSSTGNLLDKDDLAIPPPDYGAASRAFPAQTASGFKQRPYSVAVPAFSQGLDDYGARSMSRNP
Gene Sequence WFPFSYTRVLDSDGSDRLHMSLQQGKSSSTGNLLDKDDLAIPPPDYGAASRAFPAQTASGFKQRPYSVAVPAFSQGLDDYGARSMSRNP
Gene ID - Mouse ENSMUSG00000025372
Gene ID - Rat ENSRNOG00000004049
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti BAIAP2 pAb (ATL-HPA023310 w/enhanced validation)
Datasheet Anti BAIAP2 pAb (ATL-HPA023310 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti BAIAP2 pAb (ATL-HPA023310 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti BAIAP2 pAb (ATL-HPA023310 w/enhanced validation)
Datasheet Anti BAIAP2 pAb (ATL-HPA023310 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti BAIAP2 pAb (ATL-HPA023310 w/enhanced validation)
Citations for Anti BAIAP2 pAb (ATL-HPA023310 w/enhanced validation) – 6 Found
Chou, Ai Mei; Sem, Kai Ping; Lam, Wei Jun; Ahmed, Sohail; Lim, Chin Yan. Redundant functions of I-BAR family members, IRSp53 and IRTKS, are essential for embryonic development. Scientific Reports. 2017;7( 28067313):40485.  PubMed
Mancinelli, Gloria; Lamparter, Lucas; Nosov, Georgii; Saha, Tanumoy; Pawluchin, Anna; Kurre, Rainer; Rasch, Christiane; Ebrahimkutty, Mirsana; Klingauf, Jürgen; Galic, Milos. Dendrite tapering actuates a self-organizing signaling circuit for stochastic filopodia initiation in neurons. Proceedings Of The National Academy Of Sciences Of The United States Of America. 2021;118(43)  PubMed
Kim, Yangsik; Noh, Young Woo; Kim, Kyungdeok; Yang, Esther; Kim, Hyun; Kim, Eunjoon. IRSp53 Deletion in Glutamatergic and GABAergic Neurons and in Male and Female Mice Leads to Distinct Electrophysiological and Behavioral Phenotypes. Frontiers In Cellular Neuroscience. 14( 32116566):23.  PubMed
Cheng, Karen W; Mullins, R Dyche. Initiation and disassembly of filopodia tip complexes containing VASP and lamellipodin. Molecular Biology Of The Cell. 2020;31(18):2021-2034.  PubMed
Bisi, Sara; Marchesi, Stefano; Rizvi, Abrar; Carra, Davide; Beznoussenko, Galina V; Ferrara, Ines; Deflorian, Gianluca; Mironov, Alexander; Bertalot, Giovanni; Pisati, Federica; Oldani, Amanda; Cattaneo, Angela; Saberamoli, Ghazaleh; Pece, Salvatore; Viale, Giuseppe; Bachi, Angela; Tripodo, Claudio; Scita, Giorgio; Disanza, Andrea. IRSp53 controls plasma membrane shape and polarized transport at the nascent lumen in epithelial tubules. Nature Communications. 2020;11(1):3516.  PubMed
Noh, Young Woo; Yook, Chaehyun; Kang, Jaeseung; Lee, Soowon; Kim, Yeonghyeon; Yang, Esther; Kim, Hyun; Kim, Eunjoon. Adult re-expression of IRSp53 rescues NMDA receptor function and social behavior in IRSp53-mutant mice. Communications Biology. 2022;5(1):838.  PubMed