Anti BAIAP2 pAb (ATL-HPA023310 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA023310-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: BAIAP2
Alternative Gene Name: BAP2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025372: 92%, ENSRNOG00000004049: 92%
Entrez Gene ID: 10458
Uniprot ID: Q9UQB8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | WFPFSYTRVLDSDGSDRLHMSLQQGKSSSTGNLLDKDDLAIPPPDYGAASRAFPAQTASGFKQRPYSVAVPAFSQGLDDYGARSMSRNP |
| Gene Sequence | WFPFSYTRVLDSDGSDRLHMSLQQGKSSSTGNLLDKDDLAIPPPDYGAASRAFPAQTASGFKQRPYSVAVPAFSQGLDDYGARSMSRNP |
| Gene ID - Mouse | ENSMUSG00000025372 |
| Gene ID - Rat | ENSRNOG00000004049 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti BAIAP2 pAb (ATL-HPA023310 w/enhanced validation) | |
| Datasheet | Anti BAIAP2 pAb (ATL-HPA023310 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti BAIAP2 pAb (ATL-HPA023310 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti BAIAP2 pAb (ATL-HPA023310 w/enhanced validation) | |
| Datasheet | Anti BAIAP2 pAb (ATL-HPA023310 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti BAIAP2 pAb (ATL-HPA023310 w/enhanced validation) |
| Citations for Anti BAIAP2 pAb (ATL-HPA023310 w/enhanced validation) – 6 Found |
| Chou, Ai Mei; Sem, Kai Ping; Lam, Wei Jun; Ahmed, Sohail; Lim, Chin Yan. Redundant functions of I-BAR family members, IRSp53 and IRTKS, are essential for embryonic development. Scientific Reports. 2017;7( 28067313):40485. PubMed |
| Mancinelli, Gloria; Lamparter, Lucas; Nosov, Georgii; Saha, Tanumoy; Pawluchin, Anna; Kurre, Rainer; Rasch, Christiane; Ebrahimkutty, Mirsana; Klingauf, Jürgen; Galic, Milos. Dendrite tapering actuates a self-organizing signaling circuit for stochastic filopodia initiation in neurons. Proceedings Of The National Academy Of Sciences Of The United States Of America. 2021;118(43) PubMed |
| Kim, Yangsik; Noh, Young Woo; Kim, Kyungdeok; Yang, Esther; Kim, Hyun; Kim, Eunjoon. IRSp53 Deletion in Glutamatergic and GABAergic Neurons and in Male and Female Mice Leads to Distinct Electrophysiological and Behavioral Phenotypes. Frontiers In Cellular Neuroscience. 14( 32116566):23. PubMed |
| Cheng, Karen W; Mullins, R Dyche. Initiation and disassembly of filopodia tip complexes containing VASP and lamellipodin. Molecular Biology Of The Cell. 2020;31(18):2021-2034. PubMed |
| Bisi, Sara; Marchesi, Stefano; Rizvi, Abrar; Carra, Davide; Beznoussenko, Galina V; Ferrara, Ines; Deflorian, Gianluca; Mironov, Alexander; Bertalot, Giovanni; Pisati, Federica; Oldani, Amanda; Cattaneo, Angela; Saberamoli, Ghazaleh; Pece, Salvatore; Viale, Giuseppe; Bachi, Angela; Tripodo, Claudio; Scita, Giorgio; Disanza, Andrea. IRSp53 controls plasma membrane shape and polarized transport at the nascent lumen in epithelial tubules. Nature Communications. 2020;11(1):3516. PubMed |
| Noh, Young Woo; Yook, Chaehyun; Kang, Jaeseung; Lee, Soowon; Kim, Yeonghyeon; Yang, Esther; Kim, Hyun; Kim, Eunjoon. Adult re-expression of IRSp53 rescues NMDA receptor function and social behavior in IRSp53-mutant mice. Communications Biology. 2022;5(1):838. PubMed |