Anti BAHCC1 pAb (ATL-HPA023386)

Atlas Antibodies

SKU: ATL-HPA023386-25

• 

Protein Description: BAH domain and coiled-coil containing 1
Gene Name: BAHCC1
Alternative Gene Name: BAHD2, KIAA1447
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039741: 69%, ENSRNOG00000043102: 71%
Entrez Gene ID: 57597
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SLGLLCAELRGGSGGEPAKKRSKLERSVYAGLQTASVEKAQCKKSSCQGGLAPSVAHRVAQLKPKVKSKGLPTGLSSFQQKEATPGGRIREKLSRAK
• Gene Sequence: SLGLLCAELRGGSGGEPAKKRSKLERSVYAGLQTASVEKAQCKKSSCQGGLAPSVAHRVAQLKPKVKSKGLPTGLSSFQQKEATPGGRIREKLSRAK
• Gene ID - Mouse: ENSMUSG00000039741
• Gene ID - Rat: ENSRNOG00000043102
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.