Anti BAG3 pAb (ATL-HPA018493 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA018493-25
  • Immunohistochemical staining of human cerebellum, prostate, skeletal muscle and skin using Anti-BAG3 antibody HPA018493 (A) shows similar protein distribution across tissues to independent antibody HPA020586 (B).
  • Immunofluorescent staining of human cell line A-431 shows localization to plasma membrane & cytosol.
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: BCL2-associated athanogene 3
Gene Name: BAG3
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030847: 77%, ENSRNOG00000020298: 80%
Entrez Gene ID: 9531
Uniprot ID: O95817
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DSVDPEGRADVRQARRDGVRKVQTILEKLEQKAIDVPGQVQVYELQPSNLEADQPLQAIMEMGAVAADKGKKNAGNAEDPHTETQQPEATAAATSNPSSMTDTPGNPAAP
Gene Sequence DSVDPEGRADVRQARRDGVRKVQTILEKLEQKAIDVPGQVQVYELQPSNLEADQPLQAIMEMGAVAADKGKKNAGNAEDPHTETQQPEATAAATSNPSSMTDTPGNPAAP
Gene ID - Mouse ENSMUSG00000030847
Gene ID - Rat ENSRNOG00000020298
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti BAG3 pAb (ATL-HPA018493 w/enhanced validation)
Datasheet Anti BAG3 pAb (ATL-HPA018493 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti BAG3 pAb (ATL-HPA018493 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti BAG3 pAb (ATL-HPA018493 w/enhanced validation)
Datasheet Anti BAG3 pAb (ATL-HPA018493 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti BAG3 pAb (ATL-HPA018493 w/enhanced validation)