Anti BAG2 pAb (ATL-HPA019918 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA019918-25
  • Immunohistochemistry analysis in human smooth muscle and pancreas tissues using HPA019918 antibody. Corresponding BAG2 RNA-seq data are presented for the same tissues.
  • Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.
  • Western blot analysis using Anti-BAG2 antibody HPA019918 (A) shows similar pattern to independent antibody HPA018862 (B).
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: BCL2-associated athanogene 2
Gene Name: BAG2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042215: 87%, ENSRNOG00000012709: 86%
Entrez Gene ID: 9532
Uniprot ID: O95816
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SACSSEVPHGPVDQKFQSIVIGCALEDQKKIKRRLETLLRNIENSDKAIKLLEHSKGAGSKTLQQNAES
Gene Sequence SACSSEVPHGPVDQKFQSIVIGCALEDQKKIKRRLETLLRNIENSDKAIKLLEHSKGAGSKTLQQNAES
Gene ID - Mouse ENSMUSG00000042215
Gene ID - Rat ENSRNOG00000012709
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti BAG2 pAb (ATL-HPA019918 w/enhanced validation)
Datasheet Anti BAG2 pAb (ATL-HPA019918 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti BAG2 pAb (ATL-HPA019918 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti BAG2 pAb (ATL-HPA019918 w/enhanced validation)
Datasheet Anti BAG2 pAb (ATL-HPA019918 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti BAG2 pAb (ATL-HPA019918 w/enhanced validation)