Anti BAG2 pAb (ATL-HPA019918 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA019918-25

Protein Description: BCL2-associated athanogene 2
Gene Name: BAG2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042215: 87%, ENSRNOG00000012709: 86%
Entrez Gene ID: 9532
Uniprot ID: O95816
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SACSSEVPHGPVDQKFQSIVIGCALEDQKKIKRRLETLLRNIENSDKAIKLLEHSKGAGSKTLQQNAES
• Gene Sequence: SACSSEVPHGPVDQKFQSIVIGCALEDQKKIKRRLETLLRNIENSDKAIKLLEHSKGAGSKTLQQNAES
• Gene ID - Mouse: ENSMUSG00000042215
• Gene ID - Rat: ENSRNOG00000012709
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.