Anti BAD pAb (ATL-HPA062105)

Atlas Antibodies

Catalog No.:
ATL-HPA062105-25
Shipping:
Calculated at Checkout
$351.00
Adding to cart… The item has been added
Protein Description: BCL2-associated agonist of cell death
Gene Name: BAD
Alternative Gene Name: BBC2, BCL2L8
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024959: 86%, ENSRNOG00000021147: 88%
Entrez Gene ID: 572
Uniprot ID: Q92934
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NLWAAQRYGRELRRMSDEFVDSFKKGLPRPKSAGTATQMRQSSSWTRVFQSWWDRNLGR
Gene Sequence NLWAAQRYGRELRRMSDEFVDSFKKGLPRPKSAGTATQMRQSSSWTRVFQSWWDRNLGR
Gene ID - Mouse ENSMUSG00000024959
Gene ID - Rat ENSRNOG00000021147
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti BAD pAb (ATL-HPA062105)
Datasheet Anti BAD pAb (ATL-HPA062105) Datasheet (External Link)
Vendor Page Anti BAD pAb (ATL-HPA062105) at Atlas Antibodies

Documents & Links for Anti BAD pAb (ATL-HPA062105)
Datasheet Anti BAD pAb (ATL-HPA062105) Datasheet (External Link)
Vendor Page Anti BAD pAb (ATL-HPA062105)