Anti BACH2 pAb (ATL-HPA058384)
Atlas Antibodies
- Catalog No.:
- ATL-HPA058384-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: BACH2
Alternative Gene Name: BTBD25
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040270: 85%, ENSRNOG00000006170: 80%
Entrez Gene ID: 60468
Uniprot ID: Q9BYV9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, ChIP-Exo-Seq |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | SNSLKPGLARGQIKSEPPSEENEEESITLCLSGDEPDAKDRAGDVEMDRKQPSPAPTPTAPAGAACLERSRSVASPSCLRSLFSITK |
| Gene Sequence | SNSLKPGLARGQIKSEPPSEENEEESITLCLSGDEPDAKDRAGDVEMDRKQPSPAPTPTAPAGAACLERSRSVASPSCLRSLFSITK |
| Gene ID - Mouse | ENSMUSG00000040270 |
| Gene ID - Rat | ENSRNOG00000006170 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti BACH2 pAb (ATL-HPA058384) | |
| Datasheet | Anti BACH2 pAb (ATL-HPA058384) Datasheet (External Link) |
| Vendor Page | Anti BACH2 pAb (ATL-HPA058384) at Atlas Antibodies |
| Documents & Links for Anti BACH2 pAb (ATL-HPA058384) | |
| Datasheet | Anti BACH2 pAb (ATL-HPA058384) Datasheet (External Link) |
| Vendor Page | Anti BACH2 pAb (ATL-HPA058384) |