Anti BAAT pAb (ATL-HPA021330)

Atlas Antibodies

Catalog No.:
ATL-HPA021330-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: bile acid CoA:amino acid N-acyltransferase
Gene Name: BAAT
Alternative Gene Name: BAT
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039653: 72%, ENSRNOG00000007395: 72%
Entrez Gene ID: 570
Uniprot ID: Q14032
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MIQLTATPVSALVDEPVHIRATGLIPFQMVSFQASLEDENGDMFYSQAHYRANEFGEVDLNHASSLGGDYMGVH
Gene Sequence MIQLTATPVSALVDEPVHIRATGLIPFQMVSFQASLEDENGDMFYSQAHYRANEFGEVDLNHASSLGGDYMGVH
Gene ID - Mouse ENSMUSG00000039653
Gene ID - Rat ENSRNOG00000007395
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti BAAT pAb (ATL-HPA021330)
Datasheet Anti BAAT pAb (ATL-HPA021330) Datasheet (External Link)
Vendor Page Anti BAAT pAb (ATL-HPA021330) at Atlas Antibodies

Documents & Links for Anti BAAT pAb (ATL-HPA021330)
Datasheet Anti BAAT pAb (ATL-HPA021330) Datasheet (External Link)
Vendor Page Anti BAAT pAb (ATL-HPA021330)