Anti BAALC pAb (ATL-HPA068307)

Atlas Antibodies

Catalog No.:
ATL-HPA068307-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: brain and acute leukemia, cytoplasmic
Gene Name: BAALC
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032826: 31%, ENSRNOG00000004697: 53%
Entrez Gene ID: 79870
Uniprot ID: Q8WXS3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RYYESWTRETESTWLTYTDSDAPPSAAAPDSGPEAGGLHSVLEAEKSKIKAPTDSVSDEGLFSASKMAPLAVFS
Gene Sequence RYYESWTRETESTWLTYTDSDAPPSAAAPDSGPEAGGLHSVLEAEKSKIKAPTDSVSDEGLFSASKMAPLAVFS
Gene ID - Mouse ENSMUSG00000032826
Gene ID - Rat ENSRNOG00000004697
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti BAALC pAb (ATL-HPA068307)
Datasheet Anti BAALC pAb (ATL-HPA068307) Datasheet (External Link)
Vendor Page Anti BAALC pAb (ATL-HPA068307) at Atlas Antibodies

Documents & Links for Anti BAALC pAb (ATL-HPA068307)
Datasheet Anti BAALC pAb (ATL-HPA068307) Datasheet (External Link)
Vendor Page Anti BAALC pAb (ATL-HPA068307)