Anti B9D2 pAb (ATL-HPA042618 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA042618-100

• 
• 

Protein Description: B9 protein domain 2
Gene Name: B9D2
Alternative Gene Name: MGC4093, MKS10
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000063439: 98%, ENSRNOG00000028753: 95%
Entrez Gene ID: 80776
Uniprot ID: Q9BPU9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MAEVHVIGQIIGASGFSESSLFCKWGIHTGAAWKLLSGVREGQTQVDTPQIGDMAYWSHPIDLHFATKGLQGWPRLHFQVW
• Gene Sequence: MAEVHVIGQIIGASGFSESSLFCKWGIHTGAAWKLLSGVREGQTQVDTPQIGDMAYWSHPIDLHFATKGLQGWPRLHFQVW
• Gene ID - Mouse: ENSMUSG00000063439
• Gene ID - Rat: ENSRNOG00000028753
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.