Anti B9D1 pAb (ATL-HPA022957)

Atlas Antibodies

Catalog No.: ATL-HPA022957-25

Protein Description: B9 protein domain 1
Gene Name: B9D1
Alternative Gene Name: B9, EPPB9, MKS9
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001039: 95%, ENSRNOG00000047790: 98%
Entrez Gene ID: 27077
Uniprot ID: Q9UPM9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ASPSVFLLMVNGQVESAQFPEYDDLYCKYCFVYGQDWAPTAGLEEGISQITSKSQDVRQALVWN
• Gene Sequence: ASPSVFLLMVNGQVESAQFPEYDDLYCKYCFVYGQDWAPTAGLEEGISQITSKSQDVRQALVWN
• Gene ID - Mouse: ENSMUSG00000001039
• Gene ID - Rat: ENSRNOG00000047790
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.