Anti B9D1 pAb (ATL-HPA022957)
Atlas Antibodies
- Catalog No.:
- ATL-HPA022957-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: B9D1
Alternative Gene Name: B9, EPPB9, MKS9
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001039: 95%, ENSRNOG00000047790: 98%
Entrez Gene ID: 27077
Uniprot ID: Q9UPM9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | ASPSVFLLMVNGQVESAQFPEYDDLYCKYCFVYGQDWAPTAGLEEGISQITSKSQDVRQALVWN |
| Gene Sequence | ASPSVFLLMVNGQVESAQFPEYDDLYCKYCFVYGQDWAPTAGLEEGISQITSKSQDVRQALVWN |
| Gene ID - Mouse | ENSMUSG00000001039 |
| Gene ID - Rat | ENSRNOG00000047790 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti B9D1 pAb (ATL-HPA022957) | |
| Datasheet | Anti B9D1 pAb (ATL-HPA022957) Datasheet (External Link) |
| Vendor Page | Anti B9D1 pAb (ATL-HPA022957) at Atlas Antibodies |
| Documents & Links for Anti B9D1 pAb (ATL-HPA022957) | |
| Datasheet | Anti B9D1 pAb (ATL-HPA022957) Datasheet (External Link) |
| Vendor Page | Anti B9D1 pAb (ATL-HPA022957) |