Anti B4GALT7 pAb (ATL-HPA042330)

Atlas Antibodies

SKU: ATL-HPA042330-25

• 
• 

Protein Description: xylosylprotein beta 1,4-galactosyltransferase, polypeptide 7
Gene Name: B4GALT7
Alternative Gene Name: beta4Gal-T7, XGALT-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021504: 97%, ENSRNOG00000021886: 98%
Entrez Gene ID: 11285
Uniprot ID: Q9UBV7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PEHWEEDASWGPHRLAVLVPFRERFEELLVFVPHMRRFLSRKKIRHHIYVLNQVDHFRFNRAALINVGFLESSNSTDYIAMHDVDLLPLNEELDYGFPEAGPFHVASPELHPLYHYKTYVG
• Gene Sequence: PEHWEEDASWGPHRLAVLVPFRERFEELLVFVPHMRRFLSRKKIRHHIYVLNQVDHFRFNRAALINVGFLESSNSTDYIAMHDVDLLPLNEELDYGFPEAGPFHVASPELHPLYHYKTYVG
• Gene ID - Mouse: ENSMUSG00000021504
• Gene ID - Rat: ENSRNOG00000021886
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.