Anti B4GALT6 pAb (ATL-HPA058284)
Atlas Antibodies
- SKU:
- ATL-HPA058284-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: B4GALT6
Alternative Gene Name: beta4GalT-VI
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000056124: 86%, ENSRNOG00000015895: 88%
Entrez Gene ID: 9331
Uniprot ID: Q9UBX8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | TTYLPENFTYSPYLPCPEKLPYMRGFLNVNVSEVSFDEIHQLFSKDLDIEPGGHWRPKDCKPRWK |
Gene Sequence | TTYLPENFTYSPYLPCPEKLPYMRGFLNVNVSEVSFDEIHQLFSKDLDIEPGGHWRPKDCKPRWK |
Gene ID - Mouse | ENSMUSG00000056124 |
Gene ID - Rat | ENSRNOG00000015895 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti B4GALT6 pAb (ATL-HPA058284) | |
Datasheet | Anti B4GALT6 pAb (ATL-HPA058284) Datasheet (External Link) |
Vendor Page | Anti B4GALT6 pAb (ATL-HPA058284) at Atlas Antibodies |
Documents & Links for Anti B4GALT6 pAb (ATL-HPA058284) | |
Datasheet | Anti B4GALT6 pAb (ATL-HPA058284) Datasheet (External Link) |
Vendor Page | Anti B4GALT6 pAb (ATL-HPA058284) |