Anti B4GALT6 pAb (ATL-HPA058284)

Atlas Antibodies

Catalog No.:
ATL-HPA058284-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 6
Gene Name: B4GALT6
Alternative Gene Name: beta4GalT-VI
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000056124: 86%, ENSRNOG00000015895: 88%
Entrez Gene ID: 9331
Uniprot ID: Q9UBX8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TTYLPENFTYSPYLPCPEKLPYMRGFLNVNVSEVSFDEIHQLFSKDLDIEPGGHWRPKDCKPRWK
Gene Sequence TTYLPENFTYSPYLPCPEKLPYMRGFLNVNVSEVSFDEIHQLFSKDLDIEPGGHWRPKDCKPRWK
Gene ID - Mouse ENSMUSG00000056124
Gene ID - Rat ENSRNOG00000015895
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti B4GALT6 pAb (ATL-HPA058284)
Datasheet Anti B4GALT6 pAb (ATL-HPA058284) Datasheet (External Link)
Vendor Page Anti B4GALT6 pAb (ATL-HPA058284) at Atlas Antibodies

Documents & Links for Anti B4GALT6 pAb (ATL-HPA058284)
Datasheet Anti B4GALT6 pAb (ATL-HPA058284) Datasheet (External Link)
Vendor Page Anti B4GALT6 pAb (ATL-HPA058284)