Anti B4GALT6 pAb (ATL-HPA058284)

Atlas Antibodies

SKU: ATL-HPA058284-25

• 

Protein Description: UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 6
Gene Name: B4GALT6
Alternative Gene Name: beta4GalT-VI
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000056124: 86%, ENSRNOG00000015895: 88%
Entrez Gene ID: 9331
Uniprot ID: Q9UBX8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TTYLPENFTYSPYLPCPEKLPYMRGFLNVNVSEVSFDEIHQLFSKDLDIEPGGHWRPKDCKPRWK
• Gene Sequence: TTYLPENFTYSPYLPCPEKLPYMRGFLNVNVSEVSFDEIHQLFSKDLDIEPGGHWRPKDCKPRWK
• Gene ID - Mouse: ENSMUSG00000056124
• Gene ID - Rat: ENSRNOG00000015895
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.