Anti B4GALT4 pAb (ATL-HPA063546)

Atlas Antibodies

Catalog No.:
ATL-HPA063546-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 4
Gene Name: B4GALT4
Alternative Gene Name: beta4Gal-T4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022793: 80%, ENSRNOG00000003114: 80%
Entrez Gene ID: 8702
Uniprot ID: O60513
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LQRMKISRPLPEVGKYTMVFHTRDKGNEVNAERMKLLHQVSRVWRTDGLSSCSYKLVSVEHNPLYINITVDFWFGA
Gene Sequence LQRMKISRPLPEVGKYTMVFHTRDKGNEVNAERMKLLHQVSRVWRTDGLSSCSYKLVSVEHNPLYINITVDFWFGA
Gene ID - Mouse ENSMUSG00000022793
Gene ID - Rat ENSRNOG00000003114
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti B4GALT4 pAb (ATL-HPA063546)
Datasheet Anti B4GALT4 pAb (ATL-HPA063546) Datasheet (External Link)
Vendor Page Anti B4GALT4 pAb (ATL-HPA063546) at Atlas Antibodies

Documents & Links for Anti B4GALT4 pAb (ATL-HPA063546)
Datasheet Anti B4GALT4 pAb (ATL-HPA063546) Datasheet (External Link)
Vendor Page Anti B4GALT4 pAb (ATL-HPA063546)