Anti B4GALT3 pAb (ATL-HPA010793)
Atlas Antibodies
- Catalog No.:
- ATL-HPA010793-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: B4GALT3
Alternative Gene Name: beta4Gal-T3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052423: 98%, ENSRNOG00000003551: 99%
Entrez Gene ID: 8703
Uniprot ID: O60512
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human, Mouse |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | YFGGVSALTPDQYLKMNGFPNEYWGWGGEDDDIATRVRLAGMKISRPPTSVGHYKMVKHRGDKGNEENPHRFDLLVRTQNSWTQDGMNSLTYQLLARELGPLYTNITADIGTDPRGPRAPSGPRYPPGS |
| Gene Sequence | YFGGVSALTPDQYLKMNGFPNEYWGWGGEDDDIATRVRLAGMKISRPPTSVGHYKMVKHRGDKGNEENPHRFDLLVRTQNSWTQDGMNSLTYQLLARELGPLYTNITADIGTDPRGPRAPSGPRYPPGS |
| Gene ID - Mouse | ENSMUSG00000052423 |
| Gene ID - Rat | ENSRNOG00000003551 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti B4GALT3 pAb (ATL-HPA010793) | |
| Datasheet | Anti B4GALT3 pAb (ATL-HPA010793) Datasheet (External Link) |
| Vendor Page | Anti B4GALT3 pAb (ATL-HPA010793) at Atlas Antibodies |
| Documents & Links for Anti B4GALT3 pAb (ATL-HPA010793) | |
| Datasheet | Anti B4GALT3 pAb (ATL-HPA010793) Datasheet (External Link) |
| Vendor Page | Anti B4GALT3 pAb (ATL-HPA010793) |