Anti B4GALT3 pAb (ATL-HPA010793)
Atlas Antibodies
- Catalog No.:
- ATL-HPA010793-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: B4GALT3
Alternative Gene Name: beta4Gal-T3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052423: 98%, ENSRNOG00000003551: 99%
Entrez Gene ID: 8703
Uniprot ID: O60512
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human, Mouse |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | YFGGVSALTPDQYLKMNGFPNEYWGWGGEDDDIATRVRLAGMKISRPPTSVGHYKMVKHRGDKGNEENPHRFDLLVRTQNSWTQDGMNSLTYQLLARELGPLYTNITADIGTDPRGPRAPSGPRYPPGS |
Gene Sequence | YFGGVSALTPDQYLKMNGFPNEYWGWGGEDDDIATRVRLAGMKISRPPTSVGHYKMVKHRGDKGNEENPHRFDLLVRTQNSWTQDGMNSLTYQLLARELGPLYTNITADIGTDPRGPRAPSGPRYPPGS |
Gene ID - Mouse | ENSMUSG00000052423 |
Gene ID - Rat | ENSRNOG00000003551 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti B4GALT3 pAb (ATL-HPA010793) | |
Datasheet | Anti B4GALT3 pAb (ATL-HPA010793) Datasheet (External Link) |
Vendor Page | Anti B4GALT3 pAb (ATL-HPA010793) at Atlas Antibodies |
Documents & Links for Anti B4GALT3 pAb (ATL-HPA010793) | |
Datasheet | Anti B4GALT3 pAb (ATL-HPA010793) Datasheet (External Link) |
Vendor Page | Anti B4GALT3 pAb (ATL-HPA010793) |