Anti B4GALT2 pAb (ATL-HPA047739 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA047739-25

• 
• 

Protein Description: UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 2
Gene Name: B4GALT2
Alternative Gene Name: beta4Gal-T2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028541: 90%, ENSRNOG00000019609: 90%
Entrez Gene ID: 8704
Uniprot ID: O60909
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LPPCPDSPPGLVGRLLIEFTSPMPLERVQRENPGVLMGGRYTPPDCTPAQTVAVIIPFRHREH
• Gene Sequence: LPPCPDSPPGLVGRLLIEFTSPMPLERVQRENPGVLMGGRYTPPDCTPAQTVAVIIPFRHREH
• Gene ID - Mouse: ENSMUSG00000028541
• Gene ID - Rat: ENSRNOG00000019609
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.