Anti B4GALT2 pAb (ATL-HPA007620)

Atlas Antibodies

SKU:
ATL-HPA007620-25
  • Immunofluorescent staining of human cell line U-2 OS shows localization to the Golgi apparatus.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 2
Gene Name: B4GALT2
Alternative Gene Name: beta4Gal-T2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028541: 94%, ENSRNOG00000019609: 94%
Entrez Gene ID: 8704
Uniprot ID: O60909
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PYAGYFGGVSGLSKAQFLRINGFPNEYWGWGGEDDDIFNRISLTGMKISRPDIRIGRYRMIKHDRDKHNEPNPQRFTKIQNTKLTMKRDGIGSVRYQVLEVSRQPLFTNITV
Gene Sequence PYAGYFGGVSGLSKAQFLRINGFPNEYWGWGGEDDDIFNRISLTGMKISRPDIRIGRYRMIKHDRDKHNEPNPQRFTKIQNTKLTMKRDGIGSVRYQVLEVSRQPLFTNITV
Gene ID - Mouse ENSMUSG00000028541
Gene ID - Rat ENSRNOG00000019609
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti B4GALT2 pAb (ATL-HPA007620)
Datasheet Anti B4GALT2 pAb (ATL-HPA007620) Datasheet (External Link)
Vendor Page Anti B4GALT2 pAb (ATL-HPA007620) at Atlas Antibodies

Documents & Links for Anti B4GALT2 pAb (ATL-HPA007620)
Datasheet Anti B4GALT2 pAb (ATL-HPA007620) Datasheet (External Link)
Vendor Page Anti B4GALT2 pAb (ATL-HPA007620)