Anti B4GALT1 pAb (ATL-HPA010807 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA010807-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 1
Gene Name: B4GALT1
Alternative Gene Name: beta4Gal-T1, GGTB2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028413: 71%, ENSRNOG00000059461: 73%
Entrez Gene ID: 2683
Uniprot ID: P15291
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LPQLVGVSTPLQGGSNSAAAIGQSSGELRTGGARPPPPLGASSQPRPGGDSSPVVDSGPGPASNLTSVPVPHTTALSLPACPEESPLLVGPMLIEFNMPVDLELVAKQNPNVKM
Gene Sequence LPQLVGVSTPLQGGSNSAAAIGQSSGELRTGGARPPPPLGASSQPRPGGDSSPVVDSGPGPASNLTSVPVPHTTALSLPACPEESPLLVGPMLIEFNMPVDLELVAKQNPNVKM
Gene ID - Mouse ENSMUSG00000028413
Gene ID - Rat ENSRNOG00000059461
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti B4GALT1 pAb (ATL-HPA010807 w/enhanced validation)
Datasheet Anti B4GALT1 pAb (ATL-HPA010807 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti B4GALT1 pAb (ATL-HPA010807 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti B4GALT1 pAb (ATL-HPA010807 w/enhanced validation)
Datasheet Anti B4GALT1 pAb (ATL-HPA010807 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti B4GALT1 pAb (ATL-HPA010807 w/enhanced validation)
Citations for Anti B4GALT1 pAb (ATL-HPA010807 w/enhanced validation) – 7 Found
Pagan, Jose D; Kitaoka, Maya; Anthony, Robert M. Engineered Sialylation of Pathogenic Antibodies In Vivo Attenuates Autoimmune Disease. Cell. 2018;172(3):564-577.e13.  PubMed
Harrus, Deborah; Khoder-Agha, Fawzi; Peltoniemi, Miika; Hassinen, Antti; Ruddock, Lloyd; Kellokumpu, Sakari; Glumoff, Tuomo. The dimeric structure of wild-type human glycosyltransferase B4GalT1. Plos One. 13(10):e0205571.  PubMed
Hassinen, Antti; Khoder-Agha, Fawzi; Khosrowabadi, Elham; Mennerich, Daniela; Harrus, Deborah; Noel, Maxence; Dimova, Elitsa Y; Glumoff, Tuomo; Harduin-Lepers, Anne; Kietzmann, Thomas; Kellokumpu, Sakari. A Golgi-associated redox switch regulates catalytic activation and cooperative functioning of ST6Gal-I with B4GalT-I. Redox Biology. 2019;24( 30959459):101182.  PubMed
Podinovskaia, Maria; Prescianotto-Baschong, Cristina; Buser, Dominik P; Spang, Anne. A novel live-cell imaging assay reveals regulation of endosome maturation. Elife. 2021;10( 34846303)  PubMed
Stalder, Lukas; Heusermann, Wolf; Sokol, Lena; Trojer, Dominic; Wirz, Joel; Hean, Justin; Fritzsche, Anja; Aeschimann, Florian; Pfanzagl, Vera; Basselet, Pascal; Weiler, Jan; Hintersteiner, Martin; Morrissey, David V; Meisner-Kober, Nicole C. The rough endoplasmatic reticulum is a central nucleation site of siRNA-mediated RNA silencing. The Embo Journal. 2013;32(8):1115-27.  PubMed
Khoder-Agha, Fawzi; Harrus, Deborah; Brysbaert, Guillaume; Lensink, Marc F; Harduin-Lepers, Anne; Glumoff, Tuomo; Kellokumpu, Sakari. Assembly of B4GALT1/ST6GAL1 heteromers in the Golgi membranes involves lateral interactions via highly charged surface domains. The Journal Of Biological Chemistry. 2019;294(39):14383-14393.  PubMed
Wang, Yicheng; Maeda, Yusuke; Liu, Yi-Shi; Takada, Yoko; Ninomiya, Akinori; Hirata, Tetsuya; Fujita, Morihisa; Murakami, Yoshiko; Kinoshita, Taroh. Cross-talks of glycosylphosphatidylinositol biosynthesis with glycosphingolipid biosynthesis and ER-associated degradation. Nature Communications. 2020;11(1):860.  PubMed