Anti B4GALT1 pAb (ATL-HPA010807 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA010807-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: B4GALT1
Alternative Gene Name: beta4Gal-T1, GGTB2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028413: 71%, ENSRNOG00000059461: 73%
Entrez Gene ID: 2683
Uniprot ID: P15291
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LPQLVGVSTPLQGGSNSAAAIGQSSGELRTGGARPPPPLGASSQPRPGGDSSPVVDSGPGPASNLTSVPVPHTTALSLPACPEESPLLVGPMLIEFNMPVDLELVAKQNPNVKM |
| Gene Sequence | LPQLVGVSTPLQGGSNSAAAIGQSSGELRTGGARPPPPLGASSQPRPGGDSSPVVDSGPGPASNLTSVPVPHTTALSLPACPEESPLLVGPMLIEFNMPVDLELVAKQNPNVKM |
| Gene ID - Mouse | ENSMUSG00000028413 |
| Gene ID - Rat | ENSRNOG00000059461 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti B4GALT1 pAb (ATL-HPA010807 w/enhanced validation) | |
| Datasheet | Anti B4GALT1 pAb (ATL-HPA010807 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti B4GALT1 pAb (ATL-HPA010807 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti B4GALT1 pAb (ATL-HPA010807 w/enhanced validation) | |
| Datasheet | Anti B4GALT1 pAb (ATL-HPA010807 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti B4GALT1 pAb (ATL-HPA010807 w/enhanced validation) |
| Citations for Anti B4GALT1 pAb (ATL-HPA010807 w/enhanced validation) – 7 Found |
| Pagan, Jose D; Kitaoka, Maya; Anthony, Robert M. Engineered Sialylation of Pathogenic Antibodies In Vivo Attenuates Autoimmune Disease. Cell. 2018;172(3):564-577.e13. PubMed |
| Harrus, Deborah; Khoder-Agha, Fawzi; Peltoniemi, Miika; Hassinen, Antti; Ruddock, Lloyd; Kellokumpu, Sakari; Glumoff, Tuomo. The dimeric structure of wild-type human glycosyltransferase B4GalT1. Plos One. 13(10):e0205571. PubMed |
| Hassinen, Antti; Khoder-Agha, Fawzi; Khosrowabadi, Elham; Mennerich, Daniela; Harrus, Deborah; Noel, Maxence; Dimova, Elitsa Y; Glumoff, Tuomo; Harduin-Lepers, Anne; Kietzmann, Thomas; Kellokumpu, Sakari. A Golgi-associated redox switch regulates catalytic activation and cooperative functioning of ST6Gal-I with B4GalT-I. Redox Biology. 2019;24( 30959459):101182. PubMed |
| Podinovskaia, Maria; Prescianotto-Baschong, Cristina; Buser, Dominik P; Spang, Anne. A novel live-cell imaging assay reveals regulation of endosome maturation. Elife. 2021;10( 34846303) PubMed |
| Stalder, Lukas; Heusermann, Wolf; Sokol, Lena; Trojer, Dominic; Wirz, Joel; Hean, Justin; Fritzsche, Anja; Aeschimann, Florian; Pfanzagl, Vera; Basselet, Pascal; Weiler, Jan; Hintersteiner, Martin; Morrissey, David V; Meisner-Kober, Nicole C. The rough endoplasmatic reticulum is a central nucleation site of siRNA-mediated RNA silencing. The Embo Journal. 2013;32(8):1115-27. PubMed |
| Khoder-Agha, Fawzi; Harrus, Deborah; Brysbaert, Guillaume; Lensink, Marc F; Harduin-Lepers, Anne; Glumoff, Tuomo; Kellokumpu, Sakari. Assembly of B4GALT1/ST6GAL1 heteromers in the Golgi membranes involves lateral interactions via highly charged surface domains. The Journal Of Biological Chemistry. 2019;294(39):14383-14393. PubMed |
| Wang, Yicheng; Maeda, Yusuke; Liu, Yi-Shi; Takada, Yoko; Ninomiya, Akinori; Hirata, Tetsuya; Fujita, Morihisa; Murakami, Yoshiko; Kinoshita, Taroh. Cross-talks of glycosylphosphatidylinositol biosynthesis with glycosphingolipid biosynthesis and ER-associated degradation. Nature Communications. 2020;11(1):860. PubMed |