Anti B4GALT1 pAb (ATL-HPA010806 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA010806-25

• 
• 

Protein Description: UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 1
Gene Name: B4GALT1
Alternative Gene Name: beta4Gal-T1, GGTB2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028413: 92%, ENSRNOG00000059461: 91%
Entrez Gene ID: 2683
Uniprot ID: P15291
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: FRGMSISRPNAVVGRCRMIRHSRDKKNEPNPQRFDRIAHTKETMLSDGLNSLTYQVLDVQRYPLYTQITVDIGTPS
• Gene Sequence: FRGMSISRPNAVVGRCRMIRHSRDKKNEPNPQRFDRIAHTKETMLSDGLNSLTYQVLDVQRYPLYTQITVDIGTPS
• Gene ID - Mouse: ENSMUSG00000028413
• Gene ID - Rat: ENSRNOG00000059461
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti B4GALT1 pAb (ATL-HPA010806 w/enhanced validation) – 2 Found

Xie, Huyang; Zhu, Yu; Zhang, Junyu; Liu, Zheng; Fu, Hangcheng; Cao, Yifan; Li, Gaoxiang; Shen, Yijun; Dai, Bo; Xu, Jiejie; Ye, Dingwei. B4GALT1 expression predicts prognosis and adjuvant chemotherapy benefits in muscle-invasive bladder cancer patients. Bmc Cancer. 2018;18(1):590. 

Xie, Huyang; Zhu, Yu; An, Huimin; Wang, Hongkai; Zhu, Yao; Fu, Hangcheng; Wang, Zewei; Fu, Qiang; Xu, Jiejie; Ye, Dingwei. Increased B4GALT1 expression associates with adverse outcome in patients with non-metastatic clear cell renal cell carcinoma. Oncotarget. 2016;7(22):32723-30.