Anti B4GALT1 pAb (ATL-HPA010806 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA010806-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: B4GALT1
Alternative Gene Name: beta4Gal-T1, GGTB2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028413: 92%, ENSRNOG00000059461: 91%
Entrez Gene ID: 2683
Uniprot ID: P15291
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | FRGMSISRPNAVVGRCRMIRHSRDKKNEPNPQRFDRIAHTKETMLSDGLNSLTYQVLDVQRYPLYTQITVDIGTPS |
Gene Sequence | FRGMSISRPNAVVGRCRMIRHSRDKKNEPNPQRFDRIAHTKETMLSDGLNSLTYQVLDVQRYPLYTQITVDIGTPS |
Gene ID - Mouse | ENSMUSG00000028413 |
Gene ID - Rat | ENSRNOG00000059461 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti B4GALT1 pAb (ATL-HPA010806 w/enhanced validation) | |
Datasheet | Anti B4GALT1 pAb (ATL-HPA010806 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti B4GALT1 pAb (ATL-HPA010806 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti B4GALT1 pAb (ATL-HPA010806 w/enhanced validation) | |
Datasheet | Anti B4GALT1 pAb (ATL-HPA010806 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti B4GALT1 pAb (ATL-HPA010806 w/enhanced validation) |
Citations for Anti B4GALT1 pAb (ATL-HPA010806 w/enhanced validation) – 2 Found |
Xie, Huyang; Zhu, Yu; Zhang, Junyu; Liu, Zheng; Fu, Hangcheng; Cao, Yifan; Li, Gaoxiang; Shen, Yijun; Dai, Bo; Xu, Jiejie; Ye, Dingwei. B4GALT1 expression predicts prognosis and adjuvant chemotherapy benefits in muscle-invasive bladder cancer patients. Bmc Cancer. 2018;18(1):590. PubMed |
Xie, Huyang; Zhu, Yu; An, Huimin; Wang, Hongkai; Zhu, Yao; Fu, Hangcheng; Wang, Zewei; Fu, Qiang; Xu, Jiejie; Ye, Dingwei. Increased B4GALT1 expression associates with adverse outcome in patients with non-metastatic clear cell renal cell carcinoma. Oncotarget. 2016;7(22):32723-30. PubMed |