Anti B4GALNT4 pAb (ATL-HPA043276)
Atlas Antibodies
- Catalog No.:
- ATL-HPA043276-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: B4GALNT4
Alternative Gene Name: FLJ25045, NGalNAc-T1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000055629: 73%, ENSRNOG00000053075: 77%
Entrez Gene ID: 338707
Uniprot ID: Q76KP1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | YGRDGEKLTSETDGRGVHAAPSTQRAEDSSESREEEQAPEGRDLDMLFPGGAGRLPLNFTHQTPPWREEY |
| Gene Sequence | YGRDGEKLTSETDGRGVHAAPSTQRAEDSSESREEEQAPEGRDLDMLFPGGAGRLPLNFTHQTPPWREEY |
| Gene ID - Mouse | ENSMUSG00000055629 |
| Gene ID - Rat | ENSRNOG00000053075 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti B4GALNT4 pAb (ATL-HPA043276) | |
| Datasheet | Anti B4GALNT4 pAb (ATL-HPA043276) Datasheet (External Link) |
| Vendor Page | Anti B4GALNT4 pAb (ATL-HPA043276) at Atlas Antibodies |
| Documents & Links for Anti B4GALNT4 pAb (ATL-HPA043276) | |
| Datasheet | Anti B4GALNT4 pAb (ATL-HPA043276) Datasheet (External Link) |
| Vendor Page | Anti B4GALNT4 pAb (ATL-HPA043276) |