Anti B4GALNT2 pAb (ATL-HPA015721)
Atlas Antibodies
- Catalog No.:
- ATL-HPA015721-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: B4GALNT2
Alternative Gene Name: Cad, GALGT2, Sda
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000013418: 79%, ENSRNOG00000010234: 25%
Entrez Gene ID: 124872
Uniprot ID: Q8NHY0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LLPEERLRNLFSYDGIWLFPKNQCKCEANKEQGGYNFQDAYGQSDLPAVKARRQAEFEHFQRREGLPRPLPLLVQPNLPFGYPVHGVEVMPLHTVPIPGLQFEGPDA |
Gene Sequence | LLPEERLRNLFSYDGIWLFPKNQCKCEANKEQGGYNFQDAYGQSDLPAVKARRQAEFEHFQRREGLPRPLPLLVQPNLPFGYPVHGVEVMPLHTVPIPGLQFEGPDA |
Gene ID - Mouse | ENSMUSG00000013418 |
Gene ID - Rat | ENSRNOG00000010234 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti B4GALNT2 pAb (ATL-HPA015721) | |
Datasheet | Anti B4GALNT2 pAb (ATL-HPA015721) Datasheet (External Link) |
Vendor Page | Anti B4GALNT2 pAb (ATL-HPA015721) at Atlas Antibodies |
Documents & Links for Anti B4GALNT2 pAb (ATL-HPA015721) | |
Datasheet | Anti B4GALNT2 pAb (ATL-HPA015721) Datasheet (External Link) |
Vendor Page | Anti B4GALNT2 pAb (ATL-HPA015721) |
Citations for Anti B4GALNT2 pAb (ATL-HPA015721) – 3 Found |
Yu, Pu; Zhu, Lili; Cui, Kang; Du, Yabing; Zhang, Chaojie; Ma, Wang; Guo, Jia. B4GALNT2 Gene Promotes Proliferation, and Invasiveness and Migration Abilities of Model Triple Negative Breast Cancer (TNBC) Cells by Interacting With HLA-B Protein. Frontiers In Oncology. 11( 34589428):722828. PubMed |
van der Post, Sjoerd; Hansson, Gunnar C. Membrane protein profiling of human colon reveals distinct regional differences. Molecular & Cellular Proteomics : Mcp. 2014;13(9):2277-87. PubMed |
Cogez, Virginie; Vicogne, Dorothée; Schulz, Céline; Portier, Lucie; Venturi, Giulia; de Ruyck, Jérôme; Decloquement, Mathieu; Lensink, Marc F; Brysbaert, Guillaume; Dall'Olio, Fabio; Groux-Degroote, Sophie; Harduin-Lepers, Anne. N-Glycan on the Non-Consensus N-X-C Glycosylation Site Impacts Activity, Stability, and Localization of the Sd(a) Synthase B4GALNT2. International Journal Of Molecular Sciences. 2023;24(4) PubMed |