Anti B4GALNT2 pAb (ATL-HPA015721)
Atlas Antibodies
- Catalog No.:
- ATL-HPA015721-25
- Shipping:
- Calculated at Checkout
        
            
        
        
        $303.00
    
         
                            Gene Name: B4GALNT2
Alternative Gene Name: Cad, GALGT2, Sda
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000013418: 79%, ENSRNOG00000010234: 25%
Entrez Gene ID: 124872
Uniprot ID: Q8NHY0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC | 
| Reactivity | Human | 
| Clonality | Polyclonal | 
| Host | Rabbit | 
| Immunogen | LLPEERLRNLFSYDGIWLFPKNQCKCEANKEQGGYNFQDAYGQSDLPAVKARRQAEFEHFQRREGLPRPLPLLVQPNLPFGYPVHGVEVMPLHTVPIPGLQFEGPDA | 
| Gene Sequence | LLPEERLRNLFSYDGIWLFPKNQCKCEANKEQGGYNFQDAYGQSDLPAVKARRQAEFEHFQRREGLPRPLPLLVQPNLPFGYPVHGVEVMPLHTVPIPGLQFEGPDA | 
| Gene ID - Mouse | ENSMUSG00000013418 | 
| Gene ID - Rat | ENSRNOG00000010234 | 
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. | 
| Documents & Links for Anti B4GALNT2 pAb (ATL-HPA015721) | |
| Datasheet | Anti B4GALNT2 pAb (ATL-HPA015721) Datasheet (External Link) | 
| Vendor Page | Anti B4GALNT2 pAb (ATL-HPA015721) at Atlas Antibodies | 
| Documents & Links for Anti B4GALNT2 pAb (ATL-HPA015721) | |
| Datasheet | Anti B4GALNT2 pAb (ATL-HPA015721) Datasheet (External Link) | 
| Vendor Page | Anti B4GALNT2 pAb (ATL-HPA015721) | 
| Citations for Anti B4GALNT2 pAb (ATL-HPA015721) – 3 Found | 
| Yu, Pu; Zhu, Lili; Cui, Kang; Du, Yabing; Zhang, Chaojie; Ma, Wang; Guo, Jia. B4GALNT2 Gene Promotes Proliferation, and Invasiveness and Migration Abilities of Model Triple Negative Breast Cancer (TNBC) Cells by Interacting With HLA-B Protein. Frontiers In Oncology. 11( 34589428):722828. PubMed | 
| van der Post, Sjoerd; Hansson, Gunnar C. Membrane protein profiling of human colon reveals distinct regional differences. Molecular & Cellular Proteomics : Mcp. 2014;13(9):2277-87. PubMed | 
| Cogez, Virginie; Vicogne, Dorothée; Schulz, Céline; Portier, Lucie; Venturi, Giulia; de Ruyck, Jérôme; Decloquement, Mathieu; Lensink, Marc F; Brysbaert, Guillaume; Dall'Olio, Fabio; Groux-Degroote, Sophie; Harduin-Lepers, Anne. N-Glycan on the Non-Consensus N-X-C Glycosylation Site Impacts Activity, Stability, and Localization of the Sd(a) Synthase B4GALNT2. International Journal Of Molecular Sciences. 2023;24(4) PubMed | 
 
         
                             
                                        