Anti B3GNTL1 pAb (ATL-HPA024547)
Atlas Antibodies
- Catalog No.:
- ATL-HPA024547-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: B3GNTL1
Alternative Gene Name: B3GNT8
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046605: 78%, ENSRNOG00000049724: 80%
Entrez Gene ID: 146712
Uniprot ID: Q67FW5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | ASEESQAMQAHVSIILPVHNAEPWLDECLRSVLQQDFEGTMELSVFNDASKDKSGAIIEKWRVKLEDSGVHVIIGGHDSPSP |
| Gene Sequence | ASEESQAMQAHVSIILPVHNAEPWLDECLRSVLQQDFEGTMELSVFNDASKDKSGAIIEKWRVKLEDSGVHVIIGGHDSPSP |
| Gene ID - Mouse | ENSMUSG00000046605 |
| Gene ID - Rat | ENSRNOG00000049724 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti B3GNTL1 pAb (ATL-HPA024547) | |
| Datasheet | Anti B3GNTL1 pAb (ATL-HPA024547) Datasheet (External Link) |
| Vendor Page | Anti B3GNTL1 pAb (ATL-HPA024547) at Atlas Antibodies |
| Documents & Links for Anti B3GNTL1 pAb (ATL-HPA024547) | |
| Datasheet | Anti B3GNTL1 pAb (ATL-HPA024547) Datasheet (External Link) |
| Vendor Page | Anti B3GNTL1 pAb (ATL-HPA024547) |