Anti B3GNTL1 pAb (ATL-HPA024547)

Atlas Antibodies

Catalog No.:
ATL-HPA024547-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase-like 1
Gene Name: B3GNTL1
Alternative Gene Name: B3GNT8
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046605: 78%, ENSRNOG00000049724: 80%
Entrez Gene ID: 146712
Uniprot ID: Q67FW5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ASEESQAMQAHVSIILPVHNAEPWLDECLRSVLQQDFEGTMELSVFNDASKDKSGAIIEKWRVKLEDSGVHVIIGGHDSPSP
Gene Sequence ASEESQAMQAHVSIILPVHNAEPWLDECLRSVLQQDFEGTMELSVFNDASKDKSGAIIEKWRVKLEDSGVHVIIGGHDSPSP
Gene ID - Mouse ENSMUSG00000046605
Gene ID - Rat ENSRNOG00000049724
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti B3GNTL1 pAb (ATL-HPA024547)
Datasheet Anti B3GNTL1 pAb (ATL-HPA024547) Datasheet (External Link)
Vendor Page Anti B3GNTL1 pAb (ATL-HPA024547) at Atlas Antibodies

Documents & Links for Anti B3GNTL1 pAb (ATL-HPA024547)
Datasheet Anti B3GNTL1 pAb (ATL-HPA024547) Datasheet (External Link)
Vendor Page Anti B3GNTL1 pAb (ATL-HPA024547)