Anti B3GNTL1 pAb (ATL-HPA024547)
Atlas Antibodies
- Catalog No.:
- ATL-HPA024547-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: B3GNTL1
Alternative Gene Name: B3GNT8
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046605: 78%, ENSRNOG00000049724: 80%
Entrez Gene ID: 146712
Uniprot ID: Q67FW5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | ASEESQAMQAHVSIILPVHNAEPWLDECLRSVLQQDFEGTMELSVFNDASKDKSGAIIEKWRVKLEDSGVHVIIGGHDSPSP |
Gene Sequence | ASEESQAMQAHVSIILPVHNAEPWLDECLRSVLQQDFEGTMELSVFNDASKDKSGAIIEKWRVKLEDSGVHVIIGGHDSPSP |
Gene ID - Mouse | ENSMUSG00000046605 |
Gene ID - Rat | ENSRNOG00000049724 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti B3GNTL1 pAb (ATL-HPA024547) | |
Datasheet | Anti B3GNTL1 pAb (ATL-HPA024547) Datasheet (External Link) |
Vendor Page | Anti B3GNTL1 pAb (ATL-HPA024547) at Atlas Antibodies |
Documents & Links for Anti B3GNTL1 pAb (ATL-HPA024547) | |
Datasheet | Anti B3GNTL1 pAb (ATL-HPA024547) Datasheet (External Link) |
Vendor Page | Anti B3GNTL1 pAb (ATL-HPA024547) |