Anti B3GNT9 pAb (ATL-HPA062734)

Atlas Antibodies

Catalog No.:
ATL-HPA062734-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 9
Gene Name: B3GNT9
Alternative Gene Name: MGC4655
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000069920: 95%, ENSRNOG00000053895: 95%
Entrez Gene ID: 84752
Uniprot ID: Q6UX72
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VFLGMCLQRLRLTPEPHPAFRTFGIPQPSAAPHLSTFD
Gene Sequence VFLGMCLQRLRLTPEPHPAFRTFGIPQPSAAPHLSTFD
Gene ID - Mouse ENSMUSG00000069920
Gene ID - Rat ENSRNOG00000053895
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti B3GNT9 pAb (ATL-HPA062734)
Datasheet Anti B3GNT9 pAb (ATL-HPA062734) Datasheet (External Link)
Vendor Page Anti B3GNT9 pAb (ATL-HPA062734) at Atlas Antibodies

Documents & Links for Anti B3GNT9 pAb (ATL-HPA062734)
Datasheet Anti B3GNT9 pAb (ATL-HPA062734) Datasheet (External Link)
Vendor Page Anti B3GNT9 pAb (ATL-HPA062734)