Anti B3GNT9 pAb (ATL-HPA052743)

Atlas Antibodies

Catalog No.:
ATL-HPA052743-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 9
Gene Name: B3GNT9
Alternative Gene Name: MGC4655
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000069920: 91%, ENSRNOG00000053895: 91%
Entrez Gene ID: 84752
Uniprot ID: Q6UX72
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ELVVVHGLSAADIWLMWRLLHGPHGPACAHPQPVAAGPFQWDS
Gene Sequence ELVVVHGLSAADIWLMWRLLHGPHGPACAHPQPVAAGPFQWDS
Gene ID - Mouse ENSMUSG00000069920
Gene ID - Rat ENSRNOG00000053895
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti B3GNT9 pAb (ATL-HPA052743)
Datasheet Anti B3GNT9 pAb (ATL-HPA052743) Datasheet (External Link)
Vendor Page Anti B3GNT9 pAb (ATL-HPA052743) at Atlas Antibodies

Documents & Links for Anti B3GNT9 pAb (ATL-HPA052743)
Datasheet Anti B3GNT9 pAb (ATL-HPA052743) Datasheet (External Link)
Vendor Page Anti B3GNT9 pAb (ATL-HPA052743)